Align 2-oxoacid:ferredoxin oxidoreductase subunit beta; OFOR; EC 1.2.7.11 (characterized)
to candidate WP_009318293.1 NSB1T_RS17455 2-oxoacid:ferredoxin oxidoreductase subunit beta
Query= SwissProt::P72579 (305 letters) >NCBI__GCF_000473955.1:WP_009318293.1 Length = 338 Score = 181 bits (460), Expect = 2e-50 Identities = 90/196 (45%), Positives = 122/196 (62%), Gaps = 2/196 (1%) Query: 7 QWNDWCPGCGNFGILNAEQQAIVELGVDTKNVVVVSGIGCSGKIPHFFRTPISGVHTLHG 66 Q+ WCPGCG+ ++N Q+A+ ELG+ V+SGIGCS ++P++ T G HT+HG Sbjct: 16 QYVRWCPGCGDHAVVNTLQKAMAELGIPPHKTAVISGIGCSSRLPYYMNT--YGFHTIHG 73 Query: 67 RAIAFATGIKLSNPDLVVIVNGGDGDLLGIGAGHFVAAGRRNVDMVVILHDNGVYGLTKG 126 RA A ATG+K +NPDL V GDGD L IG HF+ A RRNVD+ +IL +N +YGLTKG Sbjct: 74 RAAAIATGVKTANPDLTVWQITGDGDCLAIGGNHFIHALRRNVDLNIILLNNKIYGLTKG 133 Query: 127 QASPTLKRGEKPKSLPRPNINDAVNPIALAISSGYTFVARGYAYDVKHLKELIKSAIKHK 186 Q SPT RG KS P + D P L + F AR D+ KE++ A +HK Sbjct: 134 QYSPTSDRGAVTKSSPYGTVEDPFVPAELTFGARGHFFARAIDVDLAVSKEVMVEAGRHK 193 Query: 187 GLALIDVLQPCPTYND 202 G +++++LQ C +ND Sbjct: 194 GASVVEILQNCVIFND 209 Lambda K H 0.318 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 338 Length adjustment: 28 Effective length of query: 277 Effective length of database: 310 Effective search space: 85870 Effective search space used: 85870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory