Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_022600211.1 NSB1T_RS18380 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000473955.1:WP_022600211.1 Length = 226 Score = 113 bits (282), Expect = 4e-30 Identities = 74/241 (30%), Positives = 123/241 (51%), Gaps = 21/241 (8%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 ++ + I K +G L+ L + I +G++ ++GP+GAGKTT +I L PD+G + Sbjct: 1 MIDIINIHKSYGSLEVLKGINAHIGKGEIVSIVGPSGAGKTTLLQIIGTLDKPDSGEIHI 60 Query: 69 AGKPYEPTAVHEVA---KAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTK 125 E++ I FQ +L E TA+ENVM+ IR Sbjct: 61 GEVQTGKLKKKELSVFRNNHIGFVFQFHQLLPEFTAIENVMIPALIR------------- 107 Query: 126 GFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPA 185 K + + KRA+E+LDY+ + ++K LS G+++R+ +ARAL P +I DEP+ Sbjct: 108 --KEKSSVARKRAKEILDYLNLSDRMEHKPAQLSGGEKQRVAVARALINQPDVILADEPS 165 Query: 186 AGMNATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQIA-EGNPAE 243 ++ K +L +L +RN+ +T +++ HD L + + DRV + G+ I E N E Sbjct: 166 GSLDTQNKEELHKLFFDLRNEMGQTFVIVTHDESLAL-ITDRVIHMKDGQIITPEENINE 224 Query: 244 V 244 V Sbjct: 225 V 225 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 226 Length adjustment: 23 Effective length of query: 237 Effective length of database: 203 Effective search space: 48111 Effective search space used: 48111 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory