Align L-arabinose ABC transporter, permease protein AraH (characterized)
to candidate WP_023430416.1 N177_RS01320 ABC transporter permease
Query= CharProtDB::CH_014278 (328 letters) >NCBI__GCF_000496075.1:WP_023430416.1 Length = 336 Score = 175 bits (443), Expect = 2e-48 Identities = 108/312 (34%), Positives = 169/312 (54%), Gaps = 12/312 (3%) Query: 26 GMLVVFAVLFIACAIFVPNFATFINMKGLGLAISMSGMVACGMLFCLASGDFDLSVASVI 85 G L+ A+L + + PNF ++ N+ + + G++A GM F + SG DLSV S+ Sbjct: 25 GPLLALALLIVIGMLLNPNFLSYGNLTNVLARSAFIGIIAVGMTFVITSGGLDLSVGSMA 84 Query: 86 ACAGVTTAVVINLTE----SLWI----GVAAGLLLGVLCGLVNGFVIAKLKINALITTLA 137 A T +V+NL + W+ G+ GLLLG L G VNG ++ +I A I TL Sbjct: 85 AFIAGTMIIVMNLLVPSLGASWLVVLCGLGTGLLLGALAGAVNGLLVTVGRIEAFIVTLG 144 Query: 138 TMQIVRGLAYIISDGKAVGIE---DESFFALGYANWFGLPAPIWLTVACLIIFGLLLNKT 194 TM I R L ++DG + ++ E + Y FG+ PI + II +++ KT Sbjct: 145 TMGIFRSLVTWLADGGTLSLDFTVREIYRPFYYGGIFGVAWPIIVFAIVAIIGEIVMRKT 204 Query: 195 TFGRNTLAIGGNEEAARLAGVPVVRTKIIIFVLSGLVSAIAGIILASRMTSGQPMTSIGY 254 FGR+ AIG NE+ AR + V V ++ +VL G++ IA I+ R+ S T + + Sbjct: 205 PFGRHCAAIGSNEQVARYSAVRVDLVRLSTYVLLGVLVGIATIMYVPRLGSASSSTGVLW 264 Query: 255 ELIVISACVLGGVSLKGGIGKISYVVAGILILGTVENAMNLLN-ISPFAQYVVRGLILLA 313 EL I+A ++GG LKGG G++ V G+LIL + N +NL +SP+ ++G+I++ Sbjct: 265 ELEAIAAVIIGGTVLKGGFGRVWGTVVGVLILSFIGNLLNLAALVSPYLNGAIQGVIIIL 324 Query: 314 AVIFDRYKQKAK 325 AV+ R + AK Sbjct: 325 AVMLQRERSAAK 336 Lambda K H 0.327 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 336 Length adjustment: 28 Effective length of query: 300 Effective length of database: 308 Effective search space: 92400 Effective search space used: 92400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory