Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate WP_023430416.1 N177_RS01320 ABC transporter permease
Query= uniprot:B2T9V8 (351 letters) >NCBI__GCF_000496075.1:WP_023430416.1 Length = 336 Score = 144 bits (363), Expect = 3e-39 Identities = 103/328 (31%), Positives = 166/328 (50%), Gaps = 10/328 (3%) Query: 25 ASRGKRARSELARLR----ELALLPALALLIVIGAFISPSFLTKANLISVLGASAALALV 80 A+ R S AR R L L ALALLIVIG ++P+FL+ NL +VL SA + ++ Sbjct: 4 ATSAARQPSPPARRRINFSALGPLLALALLIVIGMLLNPNFLSYGNLTNVLARSAFIGII 63 Query: 81 VLAESLIVLTGKFDLSLESTVGIAPAVGAMLVMPAASAGFGMQWPAA-AGLLAIVVVGAV 139 + + ++ +G DLS+ S ++VM G W GL +++GA+ Sbjct: 64 AVGMTFVITSGGLDLSVGSMAAFIAGT-MIIVMNLLVPSLGASWLVVLCGLGTGLLLGAL 122 Query: 140 IGFINGFLVVRLRLNAFIVTLAMLIVLRGMLVGATKGGTL---FDMPTSFFALATTIVLG 196 G +NG LV R+ AFIVTL + + R ++ GGTL F + + + G Sbjct: 123 AGAVNGLLVTVGRIEAFIVTLGTMGIFRSLVTWLADGGTLSLDFTVREIYRPFYYGGIFG 182 Query: 197 LPLSVWLAAAAFAIAAFMLRYHRLGRALYAIGGNPEAARAAGIRVERITWGVFVLGSILA 256 + + + A I ++R GR AIG N + AR + +RV+ + +VL +L Sbjct: 183 VAWPIIVFAIVAIIGEIVMRKTPFGRHCAAIGSNEQVARYSAVRVDLVRLSTYVLLGVLV 242 Query: 257 SVGGLIVTGYVGAINANQGNGMIFTVFAAAVIGGISLDGGKGTMFGALTGVLLLGVVQNL 316 + ++ +G+ +++ G AA +IGG L GG G ++G + GVL+L + NL Sbjct: 243 GIATIMYVPRLGSASSSTGVLWELEAIAAVIIGGTVLKGGFGRVWGTVVGVLILSFIGNL 302 Query: 317 LTLAQVPSFWIQ-AIYGAIILGSLMVAR 343 L LA + S ++ AI G II+ ++M+ R Sbjct: 303 LNLAALVSPYLNGAIQGVIIILAVMLQR 330 Lambda K H 0.326 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 336 Length adjustment: 29 Effective length of query: 322 Effective length of database: 307 Effective search space: 98854 Effective search space used: 98854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory