Align Short-chain alcohol dehydrogenase protein (characterized, see rationale)
to candidate WP_023430371.1 N177_RS01090 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:D8IS13 (254 letters) >NCBI__GCF_000496075.1:WP_023430371.1 Length = 245 Score = 134 bits (336), Expect = 2e-36 Identities = 84/250 (33%), Positives = 129/250 (51%), Gaps = 18/250 (7%) Query: 8 LAGKTVLITAAAQGIGRASTELFAREGARVIATDISKPHLDELAGIAGVETHLL--DVTD 65 L+G+ L+T A+ GIG A GA V + L+ LAG G H+L ++ D Sbjct: 4 LSGRKALVTGASGGIGGAIARAMHGAGATVGLSGTRAEALETLAGELGERAHVLTCNLGD 63 Query: 66 DAAIKALVAK----IGTIDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAVL 121 AA+ ALV + +G +D+L N AG + D+ W ++N A F RA + Sbjct: 64 PAAVDALVPRAEEALGGLDILVNNAGITRDNIFIRMKDEEWQTVLDVNLSAAFRLSRAAV 123 Query: 122 PGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVAQGIRCNAICP 181 M+ ++ G I+ I S V G + Y A+KA ++G++KS+A + +GI N I P Sbjct: 124 KNMMRRRYGRIIGITSIVG-VTGNPGQANYAAAKAGMIGMSKSIAQEVATRGITVNCIAP 182 Query: 182 GTIESPSLNQRISTQAKETGKSEEEVRAAFVGRQPMGRIGKAEEVAALALYLASDESNFT 241 G IE+ T + E+ R + +G P GR+G +EE+AA ALYLAS+E+ + Sbjct: 183 GFIETAM-----------TDELNEKQRESILGHVPAGRLGTSEEIAAAALYLASEEAGYV 231 Query: 242 TGSIHMIDGG 251 TG ++GG Sbjct: 232 TGQTLHVNGG 241 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 245 Length adjustment: 24 Effective length of query: 230 Effective length of database: 221 Effective search space: 50830 Effective search space used: 50830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory