Align Arabinose ABC transporter permease (characterized, see rationale)
to candidate WP_023430416.1 N177_RS01320 ABC transporter permease
Query= uniprot:A0A161GM94 (322 letters) >NCBI__GCF_000496075.1:WP_023430416.1 Length = 336 Score = 145 bits (367), Expect = 1e-39 Identities = 100/330 (30%), Positives = 162/330 (49%), Gaps = 12/330 (3%) Query: 1 MTIQNNALPTARKPLDLRRFLDDWVMLLAAIGIFVLCTLMIDNFLSPLNMRGLGLAISTT 60 MT+ +A P R LLA + V+ L+ NFLS N+ + + Sbjct: 1 MTLATSAARQPSPPARRRINFSALGPLLALALLIVIGMLLNPNFLSYGNLTNVLARSAFI 60 Query: 61 GIAACTMLYCLASGHFDLSVGSVIACAGVVAAVVMR--------DTNSVFLGISAALVMG 112 GI A M + + SG DLSVGS+ A +VM V G+ L++G Sbjct: 61 GIIAVGMTFVITSGGLDLSVGSMAAFIAGTMIIVMNLLVPSLGASWLVVLCGLGTGLLLG 120 Query: 113 LIVGLINGIVIAKLRVNALITTLATMQIVRGLAYIFANGKAVGVS---QESFFVFGNGQM 169 + G +NG+++ R+ A I TL TM I R L A+G + + +E + F G + Sbjct: 121 ALAGAVNGLLVTVGRIEAFIVTLGTMGIFRSLVTWLADGGTLSLDFTVREIYRPFYYGGI 180 Query: 170 FGVPVPILITIVCFLFFGWLLNYTTYGRNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGV 229 FGV PI++ + + ++ T +GR+ AIG N++ A + V VD ++ + + GV Sbjct: 181 FGVAWPIIVFAIVAIIGEIVMRKTPFGRHCAAIGSNEQVARYSAVRVDLVRLSTYVLLGV 240 Query: 230 IGALAGVILASRMTSGQPMIGQGFELTVISACVLGGVSLSGGIGMIRHVIAGVLILAIIE 289 + +A ++ R+ S G +EL I+A ++GG L GG G + + GVLIL+ I Sbjct: 241 LVGIATIMYVPRLGSASSSTGVLWELEAIAAVIIGGTVLKGGFGRVWGTVVGVLILSFIG 300 Query: 290 NAMNLKN-IDTFYQYVIRGSILLLAVVIDR 318 N +NL + + I+G I++LAV++ R Sbjct: 301 NLLNLAALVSPYLNGAIQGVIIILAVMLQR 330 Lambda K H 0.330 0.144 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 336 Length adjustment: 28 Effective length of query: 294 Effective length of database: 308 Effective search space: 90552 Effective search space used: 90552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory