Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate WP_023430416.1 N177_RS01320 ABC transporter permease
Query= SwissProt::P37772 (331 letters) >NCBI__GCF_000496075.1:WP_023430416.1 Length = 336 Score = 141 bits (356), Expect = 2e-38 Identities = 108/322 (33%), Positives = 156/322 (48%), Gaps = 36/322 (11%) Query: 7 PLMITIGVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGGIDLSVG 66 PL+ + V+G L P F S + N+L +AF+GIIAVGMTFVI SGG+DLSVG Sbjct: 26 PLLALALLIVIGMLLN----PNFLSYGNLTNVLARSAFIGIIAVGMTFVITSGGLDLSVG 81 Query: 67 SVIAFTGV-------FLAKVIGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFII 119 S+ AF L +G L L L++G GA GLL+ +I AFI+ Sbjct: 82 SMAAFIAGTMIIVMNLLVPSLGASWLVVLCGLGTGLLLGALAGAVNGLLVTVGRIEAFIV 141 Query: 120 TLAGMFFLRG-VSYLVSEESIPINHPI--------YDTLSSLAWKIPGGGRLSAMGLLML 170 TL M R V++L ++ ++ + Y + +AW I ++ Sbjct: 142 TLGTMGIFRSLVTWLADGGTLSLDFTVREIYRPFYYGGIFGVAWPI----------IVFA 191 Query: 171 AVVVIGIFLAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSI 230 V +IG + +T FG AIG N A + + Y+L L L GI + Sbjct: 192 IVAIIGEIVMRKTPFGRHCAAIGSNEQVARYSAVRVDLVRLSTYVL---LGVLVGIATIM 248 Query: 231 YT-QAGYALAGVGV--ELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGT 287 Y + G A + GV EL+AIA+V+IGGT+L GG G V GT+ GV I I +N Sbjct: 249 YVPRLGSASSSTGVLWELEAIAAVIIGGTVLKGGFGRVWGTVVGVLILSFIGNLLNLAAL 308 Query: 288 LSSWWTKIAIGILLFIFIALQR 309 +S + G+++ + + LQR Sbjct: 309 VSPYLNGAIQGVIIILAVMLQR 330 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 336 Length adjustment: 28 Effective length of query: 303 Effective length of database: 308 Effective search space: 93324 Effective search space used: 93324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory