Align AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_023433528.1 N177_RS16480 amino acid ABC transporter permease
Query= TCDB::Q52814 (384 letters) >NCBI__GCF_000496075.1:WP_023433528.1 Length = 379 Score = 481 bits (1239), Expect = e-140 Identities = 239/382 (62%), Positives = 288/382 (75%), Gaps = 9/382 (2%) Query: 2 SVADKPFVRTSILAAEPPPPGERGAVAWIRRNLLATPKDVILTILALALIAWAVPHLVNW 61 S D+ FVR ++ A PPP RGA W RRNL ++ + I+TILAL +AW++P L+ W Sbjct: 6 SEVDRFFVREQMVEAMPPPGVRRGAGDWFRRNLFSSVPNGIMTILALLFLAWSIPPLIQW 65 Query: 62 LFIQAVWSGPDRTFCATTLQGGIQPDGWSGACWAFISAKYDQFIFGRYPLGERWRPAIVG 121 FI AVW G +R C + PD GACWAF+ AK+ QFI+GRYP+GERWR +V Sbjct: 66 AFIDAVWEGTNREAC-------LGPD--VGACWAFVKAKFGQFIYGRYPIGERWRVDLVF 116 Query: 122 ILFILLLVPMLIPSAPRKGLNAILLFAVLPVIAFWLLHGGFGLEVVETPLWGGLMVTLVL 181 +L LVPM IPSAP K LNA+ L + PV AF LL GGFGL VV T WGGL+VTLV+ Sbjct: 117 LLLAAGLVPMAIPSAPYKALNALFLLVIFPVAAFILLTGGFGLRVVPTEFWGGLLVTLVV 176 Query: 182 SFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIEVIRGVPLITVLFMASVMLPLFLPTG 241 + GI VS P+GILLALGRRS+MP +R+L + FIE+ RGVPLITVLFM+SVMLP FLP G Sbjct: 177 AITGIVVSFPLGILLALGRRSKMPAVRLLSIAFIELWRGVPLITVLFMSSVMLPFFLPDG 236 Query: 242 WNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRLIIMPQAI 301 + DKLLRALIGV+ F+SAYMAEV+RGGLQAIPKGQ+E A ++GLGYW LII+PQA+ Sbjct: 237 VSFDKLLRALIGVAFFSSAYMAEVVRGGLQAIPKGQYEAAAAMGLGYWPMMYLIILPQAL 296 Query: 302 KLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLNFSDANWASAVTPITGLIFAGFIFW 361 KLVIP IVNTFIG FKDTSLV IIG+FDLLGIV+ NF+D+NWA+ T TG FA +FW Sbjct: 297 KLVIPGIVNTFIGLFKDTSLVLIIGLFDLLGIVQFNFTDSNWATPQTAATGFAFAALVFW 356 Query: 362 LFCFGMSRYSGFMERHLDTGHK 383 +FCFGMSRYS F+ER L+TGHK Sbjct: 357 IFCFGMSRYSMFIERRLETGHK 378 Lambda K H 0.330 0.145 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 619 Number of extensions: 32 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 379 Length adjustment: 30 Effective length of query: 354 Effective length of database: 349 Effective search space: 123546 Effective search space used: 123546 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory