Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate WP_025164931.1 TMS3_RS08955 MHS family MFS transporter
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >NCBI__GCF_000498575.2:WP_025164931.1 Length = 440 Score = 201 bits (511), Expect = 4e-56 Identities = 127/408 (31%), Positives = 206/408 (50%), Gaps = 17/408 (4%) Query: 26 KSIFSGSVGNMVEWYDWYVYAAFS-LYFAKAFFPKGDTTAQLLNTAAIFAVGFLMRPIGG 84 K + + +G +EWYD+++Y + + F + +FP D + FAVGFL RPIGG Sbjct: 9 KVVIASVIGATIEWYDFFLYGVVAGIVFNQLYFPSDDPLVSTMLAYGTFAVGFLSRPIGG 68 Query: 85 WLMGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETIGVGAPILLVFARLLQGLSVGG 144 + G + D+ GRK+ L+ ++ +M + +I L P Y++IG+ APILL+ R+ QG+ +GG Sbjct: 69 VIFGHFGDKIGRKSMLVMTMMIMGVATFLIGLVPSYDSIGIWAPILLLLLRIFQGIGLGG 128 Query: 145 EYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQTLTTEQLYDWGWRIP 204 E+G + E A K +RGF++S + L G +A GV+ +L +LT Q +WGWRI Sbjct: 129 EWGGAVLMAFEYAPKHQRGFYASLPQIGLAIGLCLASGVVAILSYSLTDTQFLEWGWRIA 188 Query: 205 FAIGALCAIVALYLRRGMEETESFAK-KEKSKESA---MRTLLRHPKELMTVVGLTMGGT 260 F + A V ++R + E+ FAK KE + E+A + + R+PK ++ +G Sbjct: 189 FLLSAGLVFVGTWIRLNVMESPEFAKVKEANAEAAIPFVDMMKRYPKNVLAGMGARYIDG 248 Query: 261 LAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQ-PIIGGLSDKVGRRPILIAF 319 + F + + YL T+ + S++ I + MC P+ G LSD++GR + Sbjct: 249 VFFNVFGVFSLSYLTQTLNLPRSEA-LIGVMAAAVVMCFTIPMFGALSDRIGRSRVYFWG 307 Query: 320 GILGTLFTVPILTTLHTIQTWWGAFFLIMAALIIVSG--YTSI---NAVVKAELFPTEIR 374 ++ L P + T G F+I A++I G Y ++ A + ELF ++R Sbjct: 308 SLITALSAFPAFWLMMTSN---GDMFMIWMAIVIPFGIFYAAVYGPEAALFCELFDAKVR 364 Query: 375 ALGVGLPYALTVSIFGGTAEYI--ALWFKSIGMETGYYWYVTACIAVS 420 G+ Y + G I AL S G +YV AVS Sbjct: 365 YTGISFVYQFSGIFASGLTPIIATALMRSSDGQPWSTCFYVLFAGAVS 412 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 440 Length adjustment: 32 Effective length of query: 407 Effective length of database: 408 Effective search space: 166056 Effective search space used: 166056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory