Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate WP_025165745.1 TMS3_RS13175 long-chain-fatty-acid--CoA ligase
Query= BRENDA::A4YDR9 (549 letters) >NCBI__GCF_000498575.2:WP_025165745.1 Length = 562 Score = 143 bits (360), Expect = 2e-38 Identities = 124/395 (31%), Positives = 181/395 (45%), Gaps = 40/395 (10%) Query: 167 YRELVKGGSRDPLPIPAKEEYSMITLYYTSGTTGLPKGVMHHHRGAFLNAMAEVLEHQMD 226 ++E +K G L + L YT GTTG+ KG M H N +A +L+ Sbjct: 187 FKEALKQGHGHDLKALTVGHDDIAVLQYTGGTTGVAKGAMLTHG----NLVANMLQVDAC 242 Query: 227 LNS--------------VYLWTLPMFHAASWGFSWATVAVGATNVCL--DKVDYPLIYRL 270 L+ + + LP++H ++ + + V L + D P + Sbjct: 243 LSQLGDDGTPLLKQGQEIMIAPLPLYHIYAFTANCMCMMVNGNLSVLITNPRDIPGFVKE 302 Query: 271 VEKERVTHMCAAPTVYVNLADYMKRNNLKFSNRVHMLVAGAAPAPATLKAMQEIGGYMCH 330 + K R + + T++V L D+ + NL FSN G A AT + Q I G C Sbjct: 303 LGKWRFSALLGLNTLFVALMDHPEFKNLDFSNLKVTNSGGTALVKATAERWQSITG--CT 360 Query: 331 V---YGLTETYGPHSICEWRREWDSLPLEEQAKLKARQGIPYVSFEMDVFDANGKPVPWD 387 V YGLTET S + QA+L GIP V D +G Sbjct: 361 VVEGYGLTETSPVASANAYGA---------QARL-GTVGIPVPGTAFKVIDDDGNEQALG 410 Query: 388 GKTIGEVVMRGHNVALGYYKNPEKTAESF-RDGWFHSGDAAVVHPDGYIEIVDRFKDLIN 446 + GE+ ++G V GY++ + TAE +GWF SGD AV+ PDGY+ IVDR KD+I Sbjct: 411 ER--GELCIKGPQVMKGYWQREDATAEVLDAEGWFKSGDVAVIDPDGYVRIVDRKKDMII 468 Query: 447 TGGEKVSSILVEKTLMEIPGVKAVAVYGTPDEKWGEVVTARIELQEGVKLTEEEVIKFCK 506 G V +E +M P V + A G PDEK GEVV + ++G L+ EE+ +CK Sbjct: 469 VSGFNVYPNEIEDVVMAHPKVASCAAIGVPDEKSGEVVKLFVVSRDG-DLSVEELKAYCK 527 Query: 507 ERLAHFECPKIVEF-GPIPMTATGKMQKYVLRNEA 540 E ++ PK + F +PMT GK+ + LR+ A Sbjct: 528 ENFTGYKVPKHIVFKDALPMTPVGKILRRELRDIA 562 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 679 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 549 Length of database: 562 Length adjustment: 36 Effective length of query: 513 Effective length of database: 526 Effective search space: 269838 Effective search space used: 269838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory