Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_034268201.1 AMYHA_RS04370 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000504245.1:WP_034268201.1 Length = 291 Score = 144 bits (362), Expect = 3e-39 Identities = 90/298 (30%), Positives = 161/298 (54%), Gaps = 13/298 (4%) Query: 1 MEYFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSI 60 M +QQL NGL GS Y L+A+G ++++G++G++NFAHG +MLG F A F++L S Sbjct: 1 MSGLLQQLFNGLVSGSFYALLALGLSVIFGMLGVVNFAHGAFYMLGAFGA---FVLLDS- 56 Query: 61 FAGLPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQ 120 AGL L +LVV +L+ + +ER+ L F L + G+++ L + I+ Sbjct: 57 -AGLS---WWLALLVVPILL-GVIGMVLERLFVHRLMHLFPLYNFLLTFGIALILQDLIR 111 Query: 121 VTQGPRNKPI--PPMVSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRA 178 + G ++P P ++ G + Q+ + V + L + W +++RT +G RA Sbjct: 112 MKYGVTSQPYARPSILDGSVDLGLFTYPKYQVFVFVFSIALSGLVWLVLSRTRVGMIVRA 171 Query: 179 TEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTAA 238 + + ++ LG++V + ++ F G ALA +AG + V S + G + F Sbjct: 172 STERAELTQSLGIDVRRWVTPVFGFGIALAGLAGVLAAPMRAVNS-SMGADLIIVIFAVV 230 Query: 239 VLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILGRPE 296 V+GG+GS+ G+V G ++G++ ++ + ++ A F ++A VL+ +P G+ GR E Sbjct: 231 VIGGLGSVLGSVAAGYIVGMVTAIGN-FYVPALSQSLVFVLMALVLLLRPAGLFGREE 287 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 291 Length adjustment: 26 Effective length of query: 274 Effective length of database: 265 Effective search space: 72610 Effective search space used: 72610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory