Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate WP_034274815.1 AMYHA_RS24060 acyl-CoA dehydrogenase family protein
Query= reanno::pseudo5_N2C3_1:AO356_26355 (375 letters) >NCBI__GCF_000504245.1:WP_034274815.1 Length = 393 Score = 312 bits (800), Expect = 9e-90 Identities = 161/372 (43%), Positives = 232/372 (62%), Gaps = 1/372 (0%) Query: 4 TEEQTQIRDMARQFAQERLKPFAAEWDREHRFPREAIAEMAELGFFGMLVPEQWGGCDTG 63 T+EQ ++ +AR F + P AEWDR + + ++AELGF G+ VPE++GG Sbjct: 17 TDEQRAVQQLARDFVDREVVPNVAEWDRAEQVDIGIVKQLAELGFLGLTVPEEYGGSGGD 76 Query: 64 YLAYAMTLEEIAAGDGACSTIMSVHNSVGCVPILKFGNDEQKAKFLTPLASGAMLGAFAL 123 +L+Y + +EE GD A I+SV + I+K+G +EQK ++ L SG L F L Sbjct: 77 HLSYCLIMEEFGRGDTAIRGIVSVSLGLVTKQIVKYGTEEQKRHWVPRLCSGESLACFGL 136 Query: 124 TEPQAGSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFI 183 TEP GSDA +L TRA +GD +++ G K FIT+G A V ++FA TD G +G++AF+ Sbjct: 137 TEPGTGSDAGNLTTRAEQDGDDWIITGQKMFITNGTWADVALIFARTD-GPGPKGVTAFL 195 Query: 184 VPTDSPGYSVARVEDKLGQHASDTCQILFEEVKVPVGNRLGEEGEGYKIALANLEGGRVG 243 PTD+ G+S ++ KLG T ++ + V+VP RLGE G+G+ IA+ L+ GR+ Sbjct: 196 APTDAEGFSRTEIKGKLGLRGQATAELTLDGVRVPDSARLGERGQGFSIAMFALDKGRMA 255 Query: 244 IAAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAAL 303 +AA VG+ARAA EA+ YA+ER FGKPI Q V LADMA + AR +V A Sbjct: 256 VAAGCVGLARAALEASVKYAKEREQFGKPIASFQLVQEMLADMAVETDAARLLVWRVADY 315 Query: 304 RDSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYRDVRVCQIYEGT 363 + G EASMAKL+ASE A K ++A+Q GGYGY++++P+ + RD RV +YEGT Sbjct: 316 IERGLTFKTEASMAKLYASEAAVKASNLAIQVFGGYGYIDEYPVSKFLRDARVLTLYEGT 375 Query: 364 SDIQRMVISRNL 375 + IQ+++I R+L Sbjct: 376 TQIQKLLIGRSL 387 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 393 Length adjustment: 30 Effective length of query: 345 Effective length of database: 363 Effective search space: 125235 Effective search space used: 125235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory