Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_034268201.1 AMYHA_RS04370 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQI0 (292 letters) >NCBI__GCF_000504245.1:WP_034268201.1 Length = 291 Score = 162 bits (410), Expect = 8e-45 Identities = 93/288 (32%), Positives = 169/288 (58%), Gaps = 5/288 (1%) Query: 1 MNLMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFIGYFLINSFQMN 60 M+ +LQQL NGL+ GS YALLALG ++++G++ ++NFAHG YM+GAF + L++S ++ Sbjct: 1 MSGLLQQLFNGLVSGSFYALLALGLSVIFGMLGVVNFAHGAFYMLGAFGAFVLLDSAGLS 60 Query: 61 FFVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLE--YGMVYLVGANT 118 +++AL+V + ++G+V+E L L H + + G++ +L+ M Y V + Sbjct: 61 WWLALLVVPILLGVIGMVLERLFVHRLMHLFPLYNFLLTFGIALILQDLIRMKYGVTSQP 120 Query: 119 RAFPQAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGKAMRAVSVDSDAA 178 A P +I DLG + Q+ + S+ L L+ +++ +T++G +RA + ++ Sbjct: 121 YARP-SILDGSVDLGLFTYPKYQVFVFVFSIALSGLVWLVLSRTRVGMIVRASTERAELT 179 Query: 179 QLMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLKSFVAAVLGGIGII 238 Q +GI+V R ++ F G ALAG AGVL A ++ MG + F V+GG+G + Sbjct: 180 QSLGIDVRRWVTPVFGFGIALAGLAGVL-AAPMRAVNSSMGADLIIVIFAVVVIGGLGSV 238 Query: 239 PGAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGILGK 286 G+ G+++G++ F + ++V+ ++ L+L++RPAG+ G+ Sbjct: 239 LGSVAAGYIVGMVTAIGN-FYVPALSQSLVFVLMALVLLLRPAGLFGR 285 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 291 Length adjustment: 26 Effective length of query: 266 Effective length of database: 265 Effective search space: 70490 Effective search space used: 70490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory