Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_034273571.1 AMYHA_RS20260 phosphoglycerate dehydrogenase
Query= curated2:A1RYE4 (339 letters) >NCBI__GCF_000504245.1:WP_034273571.1 Length = 531 Score = 201 bits (510), Expect = 5e-56 Identities = 115/286 (40%), Positives = 172/286 (60%), Gaps = 6/286 (2%) Query: 38 REELLRNIRDKDALLCLLTDKIDAEVMDAAPNLKVISTYSVGFDHIDIPEATKRGIYVTH 97 R LL + D DALL K+DAEV+ AA LKV++ VG D++++P AT+RG+ V + Sbjct: 37 RPALLEAVADADALLVRSATKVDAEVLAAANKLKVVARAGVGLDNVEVPAATERGVMVVN 96 Query: 98 TPGVLTDAVAEFTVGLILAVTRRIVEADKIIRTGQWDKPWNPYFLTGPELKGKTIGLVGL 157 P + AE V L+L+V RR+ A++ ++ G+W + TG EL GKT+G+VGL Sbjct: 97 APTSNIVSAAEHAVTLLLSVLRRVPAANQSLQGGEWKRS----SYTGVELNGKTVGVVGL 152 Query: 158 GRIGVATAKRLSSFDVKILYYDIERRWDVETVIPNMEFTDLDTLLEKSDIVSIHVPLTKE 217 G+IG A R+++FD +++ YD + +E LD LL ++DI+SIH+P T E Sbjct: 153 GKIGQLFAHRVAAFDTELIAYDPYVSAARAKQL-GIELVSLDELLSRADIISIHLPKTPE 211 Query: 218 TYHLINEERLRKMKKTAYLINTARGPVVDTEALVKALKEGWIAGAALDVFEQEPLPPNHP 277 T LI+ + L K K+ +IN ARG +VD EAL KA+ +G + GA +DVF EP + P Sbjct: 212 TKGLIDADALAKTKQGVIVINAARGGLVDEEALAKAVADGHVGGAGVDVFVTEP-TTSSP 270 Query: 278 LTKFDNVVLAPHIASATIEARQRMAELAARNLIAVLKGEMPPALVN 323 L NVV+ PH+ ++T EA+ R A+++ L+G+ P VN Sbjct: 271 LFGLPNVVVTPHLGASTAEAQDRAGTDVAKSVKLALRGDFVPDAVN 316 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 531 Length adjustment: 32 Effective length of query: 307 Effective length of database: 499 Effective search space: 153193 Effective search space used: 153193 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory