Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_049953503.1 HALLA_RS11585 electron transfer flavoprotein subunit alpha/FixB family protein
Query= BRENDA::D2RIQ3 (340 letters) >NCBI__GCF_000517625.1:WP_049953503.1 Length = 318 Score = 164 bits (415), Expect = 3e-45 Identities = 105/324 (32%), Positives = 165/324 (50%), Gaps = 10/324 (3%) Query: 14 DLWVYVEHYKGEPVHVVYELLGECRKLADKCNQKLAAVLITDDAKDVPSKLIARGADLVY 73 D+ +H +GE V YE++ R+LAD+ +L +I+ D K G D+++ Sbjct: 3 DILAVADHRRGELRDVSYEIITAGRELADETGGELHLAIISGTVDDFAEKANREGVDVIH 62 Query: 74 VCQDPAFKYYSTDEYTNAFCEMIDEYQPSSVFIGATNDGRDLGPRIAARVNTGLCADCTI 133 + ++ D YT A ++ DE P V + +G D P +A + + D Sbjct: 63 TVSYG--EEFNHDVYTQAITQLYDEVGPQYVLAPNSVNGLDYAPAVADELELPIVTDTVG 120 Query: 134 LDAEEDGLIEWTRPAAGGNIMATILCKEHRPQMGTVRPKTFKAMEPDASRTGEVINYTLK 193 L+ + + LI R GG + T+ + + T+R A P A TG+ Sbjct: 121 LETDGETLIA-NREMYGGKVETTVEIDSNSAVV-TIR----SAEWPVAEGTGDAAVEVFD 174 Query: 194 NHVDDRV--TCIRREEVVSEGEMAIDDAPFVCSGGRGMKAKENFSLLYDLAHALGGAVGG 251 +D+ + + E V+ G++ I +A + S GRG++ +EN ++ +LA AL + Sbjct: 175 ADIDEDAIGSSVNGFEEVAGGDVDISEADVLVSVGRGIEEEENLEIVRELADALDATLSS 234 Query: 252 SRAAVDEGFIEHPRQVGQSGKTVTPKIYFACGISGSVQHKAGMSKSDTIVCINKDPDAPM 311 SR VD G++ RQVGQSGK VTP +Y A GISG+VQH AGM SDTIV IN D +AP+ Sbjct: 235 SRPIVDNGWLPKNRQVGQSGKVVTPDVYIAIGISGAVQHVAGMKGSDTIVAINTDENAPI 294 Query: 312 FEISKYGIVGDALKILPLLTAKIK 335 +I+ Y I D ++P LT + + Sbjct: 295 MDIADYAIYDDLFDVVPALTEQFR 318 Lambda K H 0.318 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 318 Length adjustment: 28 Effective length of query: 312 Effective length of database: 290 Effective search space: 90480 Effective search space used: 90480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory