Align putative transporter, required for L-alanine utilization (characterized)
to candidate WP_084050300.1 Z054_RS0111900 trimeric intracellular cation channel family protein
Query= reanno::MR1:202450 (213 letters) >NCBI__GCF_000520995.1:WP_084050300.1 Length = 208 Score = 152 bits (385), Expect = 3e-42 Identities = 69/194 (35%), Positives = 123/194 (63%) Query: 9 LLWLIGILAEAMTGALAAGRKQMDLFGVVIIGCATAIGGGTLRDMLLGNYPLVWVENVHY 68 +L ++G +A ++G+L+A +++DLFG+ II T+IGGGT+RD+L+GN P+ W++N Sbjct: 6 ILDILGTIAFVISGSLSAMNRKLDLFGIFIIAFVTSIGGGTIRDILIGNTPVSWMQNTTT 65 Query: 69 LIAIAFASLLTVAIAPVMRYLSKLFLAIDALGLAVFSIVGAQKTLMLGFSPTIAVVMGLV 128 + I ++ ++ + YL D +GL VF+I+G + + G +P +++ +G Sbjct: 66 MYLIGGVTVFSIIFRNKLDYLKGSIFLFDTIGLGVFTIIGVETGINAGLAPIVSIALGTT 125 Query: 129 TGVFGGVIRDILCNQVPLIFKKELYAVISLFTAGLYITLNAYQLEEWINLVICLTLGFSL 188 TG FGGVIRDILCN++P++F+KE+YA S+ ++ L ++ L++ I + L + Sbjct: 126 TGCFGGVIRDILCNEIPVLFRKEIYATASIAGGICFMVLYSFDLDQNITYISTALLIILI 185 Query: 189 RMLALRYHWSMPTF 202 R+L ++Y S+P F Sbjct: 186 RLLVVKYKVSLPLF 199 Lambda K H 0.330 0.143 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 208 Length adjustment: 21 Effective length of query: 192 Effective length of database: 187 Effective search space: 35904 Effective search space used: 35904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory