Align Sodium:dicarboxylate symporter (characterized, see rationale)
to candidate WP_024770047.1 Z054_RS0110630 dicarboxylate/amino acid:cation symporter
Query= uniprot:A1S570 (437 letters) >NCBI__GCF_000520995.1:WP_024770047.1 Length = 440 Score = 292 bits (748), Expect = 1e-83 Identities = 175/432 (40%), Positives = 256/432 (59%), Gaps = 31/432 (7%) Query: 8 KIGLTGKILIGMGAGILIGLLLRNFFGGSEWVQDYITEGFFHVIGTIFINSLKMLVVPLV 67 KI L KI+IGM GIL G L+ G + D+I +GTIF+N LK++ VPL+ Sbjct: 3 KIALHWKIMIGMILGILFGFLMTTLSWGKGFTGDWIAP-----LGTIFVNLLKLIAVPLI 57 Query: 68 FISLVCGTCSLSEPSKLGRLGGKTLAFYLFTTAIALVVAISAAVLVQPGN---------- 117 SL+ G L + SK +GG+T+ Y+ TT IA+ + + +PGN Sbjct: 58 LASLIKGISDLKDISKFKLIGGRTIVIYILTTVIAITIGLLLVNTFKPGNGITPETIEKL 117 Query: 118 -------ASLASESMQYSAKEAPSLADVLINIVPSNPMKALSEGNM-LQIIIFAVIFGFA 169 A ++ + S ++ ++++VP N KA+S+ M LQ+I FA+ G + Sbjct: 118 TTEYAGNAKISERIAEASRQKESGPLQFIVDMVPQNAFKAMSDNKMMLQVIFFAIFLGIS 177 Query: 170 ISHIG-ERGRRVAALFDDLNEVIMRVVTLIMQLAPYGVFALMGKLALTLG-METLESVIK 227 + I + + FD LN+V++++V LIM APY VFAL+ + +T + L +++K Sbjct: 178 MLLIKPSQSEPLKKFFDSLNDVVLKMVDLIMLTAPYAVFALLANVVVTSDDPDILLALLK 237 Query: 228 YFMLVLVVLLFHGFVVYPTLLKLFSGLSPLMFIRKMRDVQLFAFSTASSNATLPVTMEAS 287 Y +V+ L V Y L+ + + SPL F++++ QL AFST+SS ATLPVTME Sbjct: 238 YAGVVVFGLALM-IVFYCILVAVITKKSPLWFLKEISPAQLLAFSTSSSAATLPVTMERV 296 Query: 288 EHRLGADNKVASFTLPLGATINMDGTAIMQGVATVFIAQVFGID-LTITDYAMVVMTATL 346 E +G D +V+SF LP+GATINMDGT++ Q VA+VFI QV + LT ++ +V+TA L Sbjct: 297 EEHIGVDKEVSSFVLPVGATINMDGTSLYQAVASVFIMQVLWPEGLTFSNQITIVLTALL 356 Query: 347 ASIGTAGVPGVGLVMLAMVLNQVGLPVE----GIALILGVDRMLDMVRTAVNVTGDTVAT 402 ASIG+A VPG G+VML +VL +G P + G+ALI VDR LDM+RT VNVTGD + Sbjct: 357 ASIGSAAVPGAGMVMLVIVLEAIGFPSDKLPIGLALIFAVDRPLDMLRTTVNVTGDATVS 416 Query: 403 VVIAKSEGALNE 414 +++AKS G L E Sbjct: 417 MIVAKSVGKLGE 428 Lambda K H 0.325 0.139 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 440 Length adjustment: 32 Effective length of query: 405 Effective length of database: 408 Effective search space: 165240 Effective search space used: 165240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory