Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_024769669.1 Z054_RS0108590 ABC transporter ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_000520995.1:WP_024769669.1 Length = 563 Score = 163 bits (412), Expect = 1e-44 Identities = 88/262 (33%), Positives = 155/262 (59%), Gaps = 7/262 (2%) Query: 45 ILEVHNLNVIY--DEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAI-R 101 +L V NL V + +E ++++ D+SF + K EILG++GESGSGK+ AIL + Sbjct: 6 LLSVQNLCVSFLSEEKENQVLY---DISFDIHKNEILGVVGESGSGKSVASLAILGLLPN 62 Query: 102 PPGKIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAIS 161 +I G +I++G+ + + E+R + +I+ + Q ++LNP + Sbjct: 63 KISRITKGDIIYDGVSLSNFNEKEYRAIRGNEIAMIFQEPMSSLNPSMKCGRQVAEILFQ 122 Query: 162 HGEADKKRVIERASELLKLVGL-DPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMD 220 H K + L + V L +P R K YP QLSGG KQR+MIA+++ PKL++ D Sbjct: 123 HTSLSKTEIKTEVLSLFEKVKLPEPDRAYKSYPHQLSGGQKQRIMIAMAIACKPKLLIAD 182 Query: 221 EPTSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKT 280 EPT+ALD+ Q+ ++ L+K++ +E ++I++++HD+ ++++A+ +LVMY+G ++E G T Sbjct: 183 EPTTALDVTVQKEIIGLLKSLQEEYKMSILFISHDLSLVSEVADHVLVMYQGKMIEYGTT 242 Query: 281 EEIIKSPLNPYTSLLVSSIPSL 302 I +P YT L+++ P + Sbjct: 243 NTIFHTPQKEYTKALINARPPM 264 Score = 147 bits (370), Expect = 9e-40 Identities = 96/281 (34%), Positives = 153/281 (54%), Gaps = 13/281 (4%) Query: 26 LFSREEKSISNGYEYKCVMILEVHNLNVIYDEG----NSRIIKAVNDVSFGVEKGEILGI 81 + ++E++ + Y +LEV N+ Y KAV+DVSF + +GE LG+ Sbjct: 287 IITKEQREQHHQDLYSQPPLLEVINVEKSYFSKVGLFGKAEFKAVDDVSFKLYEGETLGL 346 Query: 82 IGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQAS 141 +GESG GK+TL + IL+ K G+VI+ G DI ++ E R L K+I + Q Sbjct: 347 VGESGCGKSTLGNTILQL----DKANRGQVIYKGQDITQLSSSEIRSLR-KEIQLIFQDP 401 Query: 142 QNALNPVLPISEIFYHEAISHG--EADKKRVIERASELLKLVGLDPARVLKMYPFQLSGG 199 +LNP L + + +H DK+R ++ ELL+ V L YP + SGG Sbjct: 402 FASLNPRLAVGKAIMEPMQAHNLYNNDKERK-QKVIELLERVSLTEEH-FNRYPHEFSGG 459 Query: 200 MKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNI 259 +QR+ IA ++ L PKLI+ DE SALD+ Q +L L+ + G T ++++HD+ + Sbjct: 460 QRQRIGIARTIALQPKLIICDESVSALDISVQAQVLNLLNELKSNFGFTYIFISHDLAVV 519 Query: 260 AQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVSSIP 300 ++++LLVM KG + E+G + I ++P YT L+ +IP Sbjct: 520 KYMSDQLLVMNKGKIEEQGDADLIYENPQKEYTKKLIQAIP 560 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 362 Length of database: 563 Length adjustment: 33 Effective length of query: 329 Effective length of database: 530 Effective search space: 174370 Effective search space used: 174370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory