Align Ornithine aminotransferase; OAT; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_024771205.1 Z054_RS0116790 aspartate aminotransferase family protein
Query= SwissProt::P38021 (401 letters) >NCBI__GCF_000520995.1:WP_024771205.1 Length = 396 Score = 197 bits (502), Expect = 3e-55 Identities = 132/393 (33%), Positives = 206/393 (52%), Gaps = 36/393 (9%) Query: 23 HPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQADKITLTSRAF 82 HPL I +S A+G+++ D +Y+D ++ SA + GH+HP+II+A+KDQ DK Sbjct: 15 HPLAIEVSHAIGSYIYDTNNKKYLDFVAGVSACSLGHKHPRIIRAVKDQLDKY------L 68 Query: 83 HNDQLGPFYEKTA----KLTGKEMILPM------NTGAEAVESAVKAARRWAYEVKGVAD 132 H G + ++ A KL + P+ N+G EA+E ++K ARR Sbjct: 69 HVMVYGEYIQQPAVELTKLLASHLPHPLEKTYLTNSGTEAIEGSLKLARR--------VT 120 Query: 133 NQAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAITPNTAA 192 +++IIA +HG TM ++S+ EE K+ F P++P I + D + ++Q IT T A Sbjct: 121 GRSQIIAAKLAYHGNTMGSMSVMGYEERKQAFRPLIPDTAFITFNDEKDIKQ-ITRKTGA 179 Query: 193 FLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWDGIVPD 252 + E IQG AG + P +L++ C+E L I DEIQ G GRTGK F I+PD Sbjct: 180 VILETIQGGAGFIEPKYEYLKKVKKQCEEVGALLILDEIQPGFGRTGKLFGFQNYDIIPD 239 Query: 253 MYILGKALGGGVFPISCIAADREILGVF--NPG-SHGSTFGGNPLACAVSIASLEVLEDE 309 + ++GK +GGG+ P+ A ++ NP H +TFGGNP+ A ++A+L+ + + Sbjct: 240 IVVMGKGMGGGL-PVGAFTASTTMMDQLQDNPKLGHITTFGGNPVIAAAALATLQEITES 298 Query: 310 KLADRSLELGEYFKSELESIDSPVIKEVRGRGLFIG--VELTEAARPYCERLKEEGLLC- 366 + +LE + F+S L P+IKEVRG GL + E + ++ GL+ Sbjct: 299 DVMAATLEKEKLFRSLL---IHPLIKEVRGLGLMLAFITPSAEITNQVILKCQDHGLILF 355 Query: 367 -KETHDTVIRFAPPLIISKEDLDWAIEKIKHVL 398 IR PPL IS+ ++ + I VL Sbjct: 356 WLLFEPLAIRITPPLTISESEIREGCQIILTVL 388 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 396 Length adjustment: 31 Effective length of query: 370 Effective length of database: 365 Effective search space: 135050 Effective search space used: 135050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory