Align Glucose/galactose porter (characterized)
to candidate WP_024771487.1 Z054_RS0118270 sugar MFS transporter
Query= TCDB::P0C105 (412 letters) >NCBI__GCF_000520995.1:WP_024771487.1 Length = 478 Score = 359 bits (922), Expect = e-104 Identities = 202/475 (42%), Positives = 273/475 (57%), Gaps = 79/475 (16%) Query: 9 NPLHTETSSQKNYGFALTSLTLLFFMWGFITCLNDILIPHLKNVFQLNYTQSMLIQFCFF 68 N L T++ Q NY ++ LFF+WGFIT +ND+LIPHLK VF+L+Y Q+ LIQF FF Sbjct: 6 NSLLTKSERQNNYNKPFFAIIFLFFLWGFITVMNDVLIPHLKAVFELSYFQAALIQFAFF 65 Query: 69 GAYFIVSL-------PAGQLVKRISYKRGIVVGLIVAAIGCALFIPAASYRVYALFLGAL 121 GA+FI+SL G + +I YK GI++GLI+ IGC LF PAASY+ YA+FLGAL Sbjct: 66 GAFFIISLIYFITSVSIGDPISKIGYKNGIIIGLILCGIGCCLFYPAASYQRYAIFLGAL 125 Query: 122 FVLASGVTILQVAANPYVTILGKPETAASRLTLTQAFNSLGTTVAPVFGAVLILSAATDA 181 FVLASGVTILQ+ ANPY ILGKPETA SRL L Q FNS GTT+AP+ GA+L+ +D Sbjct: 126 FVLASGVTILQITANPYAAILGKPETAPSRLNLAQGFNSFGTTLAPIVGAILLYKVFSDG 185 Query: 182 TVNAEADAVRFPYLLLALAFTVLAIIFAILKPPDVQEDEPALSDKKEGSAWQYRHLVLGA 241 + D+++ PYL+ F VLAII +K P +E +K ++RH+VLG Sbjct: 186 EITV--DSLKMPYLIYGSLFFVLAIIIKFVKLPSFINNEKI---EKGLGVLKFRHVVLGM 240 Query: 242 IGIFVYVGAEVSVGSFLVN------------------------------FLSDPTVAGLS 271 IF YVG EVS+GSFL+N FL +++G++ Sbjct: 241 FAIFFYVGGEVSIGSFLINFFGLETVMGMKEAEAGVFLSYYWGGAMIGRFLGSVSMSGIT 300 Query: 272 ETDAAH-----------HVAYFWGGAMVGRFIGSAAMRYIDDGKALAFNAF--------- 311 T + V YF + G+ +++++ K F F Sbjct: 301 STRKKYLLMALLSVLFFFVLYFITAIKIEA--GTFSLQFLSFSKIWLFVVFLISNYLFFL 358 Query: 312 ---------------VAIILLFITVATTGHIAMWSVLAIGLFNSIMFPTIFSLALHGLGS 356 + I+LL I + G IA WS +AIG FNSI++ IF+LA+ LG Sbjct: 359 IGGTKPSKVLTLFVGIIIVLLLIMILCNGEIAFWSAIAIGAFNSILWSNIFTLAIKDLGK 418 Query: 357 HTSQGSGILCLAIVGGAIVPLIQGALADAIGIHLAFLMPIICYAYIAFYGLIGSK 411 +TSQ S +L + IVGGA++PL+QG +AD IGI L+F +P+ICY Y+ FYGL+G K Sbjct: 419 YTSQASSLLVMMIVGGALIPLLQGVVADYIGIKLSFFIPVICYGYLIFYGLVGYK 473 Lambda K H 0.328 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 719 Number of extensions: 40 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 412 Length of database: 478 Length adjustment: 32 Effective length of query: 380 Effective length of database: 446 Effective search space: 169480 Effective search space used: 169480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory