Align β-galactosidase (Mbgl) (EC 3.2.1.23) (characterized)
to candidate WP_024770669.1 Z054_RS0113925 family 1 glycosylhydrolase
Query= CAZy::AEQ38581.1 (447 letters) >NCBI__GCF_000520995.1:WP_024770669.1 Length = 437 Score = 320 bits (819), Expect = 7e-92 Identities = 167/436 (38%), Positives = 252/436 (57%), Gaps = 13/436 (2%) Query: 15 WGVASAAYQIEGAVNEDGRSPSIWDTFSHTPGNLKTGENGDVACDFYHRYHDDIAFIREM 74 WGVA AA+Q EGA N+DG+ SIWDTF+ P +K N +A DFYHR+ +DI ++ Sbjct: 9 WGVAIAAHQTEGAYNKDGKGLSIWDTFTQKPYRVKDRSNARIATDFYHRFEEDIDLAVDI 68 Query: 75 NMQVHRFSLAWPRILPGGTGPVNQKGLDFYHRVIDRTLELGLQPWVTLIHWDLPQCWRQG 134 +Q+ RFS++W RI P GTG VN KG+++Y +V++ L++G++PW+T HWDLPQ + Sbjct: 69 GLQIFRFSISWSRIFPEGTGVVNPKGIEYYDKVVNYCLKVGIEPWITTYHWDLPQKLQDK 128 Query: 135 AAGTNRDICGLVSQLRGKVCSMSFGGLDQAT-WNVASRCPTVL--GYMQGTHAPGRRGFG 191 TNR+I +S + + D+ W + + + GY G HAPG++G Sbjct: 129 GGWTNRNI---ISWYAAYITVLRDHFADRVKHWVLINEGIVCIGGGYFLGVHAPGKKGIR 185 Query: 192 NFLPAVHHAALAQAEGGRVLRAHVPDAQIGTTFSASYVQPAGPTWLSRMAAANYDVIANR 251 NF+ + HH LAQAEG ++L+ + Q+GT S + ++P AA D + NR Sbjct: 186 NFISSTHHLLLAQAEGFKILK-EKKELQVGTAISCTKIEPYRNKIADHNAAIRIDTLMNR 244 Query: 252 LFLEPALGLGYPWKTTPFLLALQRYIRPGDMERLAFNFDFIGLQTYFRQLVRFDLLNPGT 311 LF+EP LGLGYP P L + +Y + GDME L +FDF G+QTY R++V+ P Sbjct: 245 LFIEPHLGLGYPDDDFPVLKRMSKYYKKGDMEALKTDFDFWGIQTYAREVVKAAWYVPYL 304 Query: 312 WGREVPHAERGSKELTEMGWEVWPENIYRLLKQFAAYKGVKRIIITENGAAFPDKLEGEQ 371 +V +R K + MGWE +PE + L++FA Y K + ++E G A E Sbjct: 305 GAIQVKPEKRNVK-TSVMGWETYPEGVQYFLERFAQYNPKKTLWLSECGMAL-----SEN 358 Query: 372 VHDPQRIQFVQDHLAQVLRAKQEGVPVEGYFYWSLLDNFEWAEGYRPRFGLVYVDYPTQK 431 D RI++ Q + + + + ++G W+L+DNFEWAEGY P+FG++ +D T + Sbjct: 359 EDDQIRIEYYQRVIKGMETMLDKNINLKGILLWTLVDNFEWAEGYIPKFGIISLDRKTMQ 418 Query: 432 RVLKDSGKWFRAFLAN 447 R +K S W + +L+N Sbjct: 419 RRMKKSALWLKKYLSN 434 Lambda K H 0.323 0.140 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 641 Number of extensions: 43 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 437 Length adjustment: 32 Effective length of query: 415 Effective length of database: 405 Effective search space: 168075 Effective search space used: 168075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory