Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_024769624.1 Z054_RS0108365 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_000520995.1:WP_024769624.1 Length = 294 Score = 87.4 bits (215), Expect = 3e-22 Identities = 65/210 (30%), Positives = 115/210 (54%), Gaps = 11/210 (5%) Query: 19 QALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFDDKDITDWQTAKIM 78 QAL++V+L + +G + L+G NGAGK+TL+ T+ A SG I FD D+ ++ + + Sbjct: 16 QALNDVNLTLEKG-MFGLLGPNGAGKSTLMRTIATLQLADSGTIDFDGIDV--FKQPREL 72 Query: 79 REAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWVYELFPR--LHERRIQRAG 136 R+ + +P+ V+ +++ E L QER +V +L + L++ R + G Sbjct: 73 RKILGYLPQDFGVYPKVSAEMMLNHIAKVKGITNSQERKGYVADLLNKVNLYKFRNRNLG 132 Query: 137 TMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQLREQGMTIF---LV 193 SGG +Q I +AL+ NP+L+++DEP+ GL P+ + + + +L E + I +V Sbjct: 133 DFSGGMRQRFGIAQALLGNPKLIIVDEPTAGLDPLERNRFHNLLSELGENAVVILSTHIV 192 Query: 194 EQNAN--QALKLADRGYVLENGH-VVLSDT 220 + N Q + + + G +L G+ LSDT Sbjct: 193 DDVTNLCQNMAVFNEGKILVQGNPQTLSDT 222 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 294 Length adjustment: 25 Effective length of query: 212 Effective length of database: 269 Effective search space: 57028 Effective search space used: 57028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory