GapMind for catabolism of small carbon sources

 

Protein WP_024891737.1 in Luteimonas huabeiensis HB2

Annotation: NCBI__GCF_000559025.1:WP_024891737.1

Length: 628 amino acids

Source: GCF_000559025.1 in NCBI

Candidate for 95 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 42% 73% 236.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 44% 77% 224.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 40% 85% 211.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 77% 205.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 71% 187.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
sucrose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 71% 187.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
trehalose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 71% 187.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-lysine catabolism hisP med Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 41% 91% 176.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 42% 81% 172.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 44% 84% 165.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-asparagine catabolism aatP med ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 41% 88% 152.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-aspartate catabolism aatP med ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 41% 88% 152.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-glutamate catabolism gltL med ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 41% 88% 152.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 221.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 221.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 221.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 221.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 221.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 221.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 39% 90% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 37% 93% 218.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-mannitol catabolism mtlK lo MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 35% 99% 217.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 36% 93% 215.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 37% 94% 211.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 99% 211.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 37% 86% 208.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 38% 87% 208.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 38% 82% 206.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 86% 204.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 37% 88% 203.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 37% 90% 201.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 37% 90% 201.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 36% 84% 199.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 34% 84% 196.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 33% 96% 195.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 35% 93% 194.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 35% 93% 193.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 34% 95% 193.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 34% 86% 191 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 79% 190.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 79% 190.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 79% 190.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 79% 190.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 79% 190.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 79% 190.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 79% 190.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 79% 190.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 33% 88% 189.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 35% 90% 183.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 77% 179.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 77% 179.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 77% 179.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 77% 179.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 35% 69% 174.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 37% 60% 169.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 83% 163.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 35% 86% 162.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 81% 162.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 34% 99% 156.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 97% 156 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 37% 91% 153.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 37% 91% 153.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 153.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 153.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 37% 93% 152.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 37% 71% 152.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 35% 93% 152.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 36% 93% 148.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 147.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 147.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 147.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 147.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 147.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 34% 97% 146.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 36% 95% 143.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 36% 90% 142.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 93% 142.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 33% 98% 140.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 32% 98% 138.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 32% 98% 138.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 35% 78% 125.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 31% 73% 119.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-isoleucine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 93% 115.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-leucine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 93% 115.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-valine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 93% 115.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 32% 98% 113.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 31% 72% 109.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 42% 251.5

Sequence Analysis Tools

View WP_024891737.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSLEVQGLTKRYAGRAVVQDVSFRVEAGELIVLLGPSGSGKSTVLRIVAGLTAADAGRVR
VDGHDVTGLPPQQRDLGFVFQNYALFEHLSVADNVEFALRVRGVDRRTRQARREELLELV
GLGGSARKFPSQLSGGQRQRTALARALAHSPRLLLLDEPFGALDARIRQELRQGLRDLLK
RLGATAIFVTHDQEEAFAVADRIMVLHRGRLLEAGTPRQLYREPRTEFVASFVGRANLLP
GELTAAGARIRLLPGARDPDAVPQRVKILLRPETLRLLRADAPAPAAREAFVHPAVVERV
EYLGASERVYLSLHAGAGARARRFLLEALRANEAAERLPLAPGDAVTLYAEHLHAVPQPD
LRVLVVAPDDADGHALAVRALAWGERTHALVTLLGGAVRAPALRAPLERYRQAFAGDLRM
VDPSPHEADPWQAAQAHLAGESYDLVILPAGMREPARLLAFLQATGTRQVLLAAAQGDPL
AAASPARWLVLLRAFAASPPDLQLLAEIAGASGADVEVRDLQPDEPGDEATGWRDALARR
SVAWTEDRDADAAAEAARRGGLPLDADADVIALDLGPHAALGPRHQSRLRALDGRWALLM
VQPDEADLALLPSAEFARRAAPGAAAAD

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory