Align L-lactate oxidase (EC 1.1.3.2) (characterized)
to candidate WP_043689996.1 Z164_RS0112045 alpha-hydroxy-acid oxidizing enzyme
Query= BRENDA::Q8Z0C8 (365 letters) >NCBI__GCF_000559025.1:WP_043689996.1 Length = 362 Score = 283 bits (725), Expect = 4e-81 Identities = 157/354 (44%), Positives = 216/354 (61%), Gaps = 3/354 (0%) Query: 10 LFEYEQLAKTHLSQMAFDYYISGAGDEITLQENRAVFERIKLRPRMLVDVSQINLTTSVL 69 L +YE +A+ L + Y +GA D I + NR F R++L PR + V+ + + Sbjct: 4 LQDYEAMAERCLDPGVWAYLNAGAADGIVHRRNREAFARVELLPRAMRRVAGGSAAVELF 63 Query: 70 GQPLQLPLLIAPMAFQCLAHTEGELATAMAAASAGTGMVLSTLSTKSLEEVAEVGSKFSP 129 G P LIAP A+ LAH +GE ATA+AAA+ V+ST ++ SLE++A P Sbjct: 64 GARHPHPFLIAPTAYHALAHPDGERATALAAAALQAPFVVSTQASASLEDIARWAE---P 120 Query: 130 SLQWFQLYIHKDRGLTRALVERAYAAGYKALCLTVDAPVLGQRERDRRNEFVLPPGLHLA 189 + WFQLY+ + R ++ LV RA AAGY+A+ TVDAP+ G R DRR F LPPG+ Sbjct: 121 APLWFQLYLQETREVSLDLVRRAEAAGYRAIVATVDAPIQGLRNEDRRRGFALPPGVQPV 180 Query: 190 NLTTISGLNIPHAPGESGLFTYFAQQLNPALTWDDLEWLQSLSPLPLVLKGILRGDDAAR 249 NL G + ++G + ++ W DL W+ + + LP+++KG+L D Sbjct: 181 NLARYGGARMGTVAVDAGASIFGHPRVAAMPDWSDLGWIAARTELPVLVKGLLHPLDVEP 240 Query: 250 AVEYGAKAIVVSNHGGRQLDGAIASLDALPEIVAAVNGKAEVLLDGGIRRGTDIIKALAI 309 A+ GA ++VSNHGGR LD A+LDALP +VAAV G+ VL+DGGIRRGTD IKALA+ Sbjct: 241 ALGAGAAGVIVSNHGGRVLDALPATLDALPGVVAAVAGRVPVLMDGGIRRGTDAIKALAL 300 Query: 310 GAQAVLIGRPVLWGLAVGGQAGVSHVISLLQKELNVAMALIGCSQLQDIDTSFL 363 GA AVL+GRP+L GLAVGG AG +HV++LL+ EL +AM L G L D + L Sbjct: 301 GASAVLVGRPILHGLAVGGAAGAAHVLNLLRAELEMAMVLCGLESLADAGPALL 354 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 362 Length adjustment: 29 Effective length of query: 336 Effective length of database: 333 Effective search space: 111888 Effective search space used: 111888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory