Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_024888811.1 Z164_RS0100590 SDR family oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000559025.1:WP_024888811.1 Length = 255 Score = 95.1 bits (235), Expect = 1e-24 Identities = 79/253 (31%), Positives = 115/253 (45%), Gaps = 22/253 (8%) Query: 10 GLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEK 69 G VA++TG ASG+G AT E L QGA V + GG +A + V ADV E Sbjct: 15 GRVAIVTGAASGIGRATVELLHRQGARIVAV---GRGGNVEALAR-DGIVPVVADVAQET 70 Query: 70 DVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVI 129 A+ A +FGR+D+ VN AGI + + +LE++ RVL VN G F Sbjct: 71 SAALAVETALERFGRLDILVNNAGIIINRPVAEM------SLEEWNRVLAVNATGAFLFS 124 Query: 130 RLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPI 189 R P G I+N S A ++ G AAY+ASKG + +T +A + Sbjct: 125 RAAM------RPMMAAGSGAIVNIGSYACYQSFAGIAAYAASKGALAQLTRTLALEAIGH 178 Query: 190 GIRVMTIAPGLFGTPLLTSLPEKVCNFLAS---QVPFPSRLGDPAEYAHLVQAIIEN--P 244 GIRV + G T + ++ +LA + P R P E A + + + Sbjct: 179 GIRVNAVGSGDAVTNITNAIQPDGQAYLAQHGRKAPI-GRAARPEEIAEVAAFLASDKAS 237 Query: 245 FLNGEVIRLDGAI 257 ++ G V+ DG + Sbjct: 238 YIVGAVVMADGGM 250 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 255 Length adjustment: 24 Effective length of query: 237 Effective length of database: 231 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory