Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_024890661.1 Z164_RS0110540 acetoacetyl-CoA reductase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000559025.1:WP_024890661.1 Length = 246 Score = 117 bits (292), Expect = 3e-31 Identities = 86/250 (34%), Positives = 124/250 (49%), Gaps = 16/250 (6%) Query: 9 IVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKAREL---GDNARFAVADISDEQA 65 +V+G GLG A + L AG +V+ DL+ QA A E G FA D++D A Sbjct: 7 VVTGGLGGLGTAICRHLARAGHRVVAADLDGQAERLAAFETAMHGLEVEFAALDVADFDA 66 Query: 66 AQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFNLLRLA 125 V + G+L LVN AGI + L K A + V++VNL FNL R A Sbjct: 67 CGRFVADVQARHGALDVLVNNAGIT-RDVTLRKMDR---AQWQDVVDVNLGSVFNLCRHA 122 Query: 126 AAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELARFGIR 185 M E G I+N +S+ GQ GQ Y+A+K + T+ ARE+AR G+ Sbjct: 123 VGGMVERGF------GRIVNLSSVNGQTGQFGQTNYSAAKAGMHGFTMALAREVARKGVT 176 Query: 186 VMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHII--ENSMLNGEV 243 V T++PG ET ++ M + +RA + VP RLGRP+E A ++ E + G Sbjct: 177 VNTVSPGYCETALVMRMPEAIRAGIVEQVPV-GRLGRPEEIARAVAFLVDEEAGFVTGAN 235 Query: 244 IRLDGALRMA 253 + ++G L M+ Sbjct: 236 LPVNGGLFMS 245 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 246 Length adjustment: 24 Effective length of query: 231 Effective length of database: 222 Effective search space: 51282 Effective search space used: 51282 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory