Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_043689696.1 Z164_RS20265 SDR family oxidoreductase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000559025.1:WP_043689696.1 Length = 256 Score = 118 bits (295), Expect = 1e-31 Identities = 90/263 (34%), Positives = 131/263 (49%), Gaps = 22/263 (8%) Query: 3 IANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKAREL--GDNARFAVADI 60 + +K I++G + G+G ATAQ + GA V+LVDL+ A+ A AREL GD AD+ Sbjct: 4 LEDKIAIITGGSGGIGKATAQRFLAEGAHVVLVDLDDDALGAAARELDGGDRVLTVRADV 63 Query: 61 SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFN 120 S E+ + V A + G + N AGI G L Q LA F KV+ VN+ G++ Sbjct: 64 SREEDVRGYVSATLERHGRIDVFFNNAGIEGKVAPLESQE---LAMFDKVLAVNVRGAYL 120 Query: 121 LLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELA 180 LR M E + G +INT+S+A G G Y SK A++ +T AA E A Sbjct: 121 GLREVLPRMYERRS------GSVINTSSVAGLRGSAGVLPYVTSKHALSGMTKVAALEAA 174 Query: 181 RFGIRVMTIAPGIFETPMMAGM--------SDEVRASLAAGVPFPPRLGRPQEYAALARH 232 ++ +RV +I P T MM + ++ RA +AA +P R G E A+L Sbjct: 175 KYEVRVNSIHPSPVNTRMMRSLEAGFDPSDAEAARAGMAANIPL-GRYGESDEIASLVLF 233 Query: 233 II--ENSMLNGEVIRLDGALRMA 253 + E+ + G R+DG + A Sbjct: 234 LASDESRFITGAQYRIDGGMGAA 256 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 256 Length adjustment: 24 Effective length of query: 231 Effective length of database: 232 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory