Align 3-methyl-2-oxobutanoate dehydrogenase subunit alpha; Branched-chain alpha-ketoacid dehydrogenase E1 component subunit alpha; BCKADH E1-alpha; EC 1.2.4.4 (characterized)
to candidate WP_024891571.1 Z164_RS0115360 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
Query= SwissProt::P9WIS3 (367 letters) >NCBI__GCF_000559025.1:WP_024891571.1 Length = 356 Score = 220 bits (561), Expect = 4e-62 Identities = 132/342 (38%), Positives = 180/342 (52%), Gaps = 4/342 (1%) Query: 16 DLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTP 75 ++E +Q +GPDG P H D P + L+ M+ R D++ + LQR G+L Y Sbjct: 8 EIEYLQYLGPDGKPVGALPEHAD-PARMVE-LFRQMLFVRTFDSKAIALQRTGKLGTYAS 65 Query: 76 CRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCC 135 C G EA VG A +R D P YRE G +RG+ P V + W G G + Sbjct: 66 CLGHEATHVGIGAAMRPEDVFAPSYREYGAQFMRGVHPREVLMYWGGDERGNDFEIPRHD 125 Query: 136 APMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVF 195 P VPI TQ LHA GAA+A + E V V GDG +S+ D + A+N A + P V Sbjct: 126 FPWCVPIATQCLHAAGAALAFKLRGEPRVAVTCCGDGGSSKTDTYAAINSAGAYDLPFVQ 185 Query: 196 YVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDG 255 + NN WAIS+P QT A ++A K + G+ ++VDGND+ A M A RAR+G G Sbjct: 186 CIINNGWAISVPRKAQTGARTLAQKGLAGGLYCLQVDGNDLFAVLEGMRRAMERARSGQG 245 Query: 256 PTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLEEQVT 315 +++E +TYRL HTTADD RYR + EV +PI R RT+L D G W + E Sbjct: 246 GSVVEFLTYRLHDHTTADDARRYRDEAEVKAAWEREPIARLRTWLTDNGHWDEERERAWA 305 Query: 316 AR-AKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQR 356 + V +E+ DA V+ +F +YA+ P L AQR Sbjct: 306 EECGRRVDAEI-DAYLGTQVQPVEAMFDYLYADPPPDLLAQR 346 Lambda K H 0.320 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 356 Length adjustment: 29 Effective length of query: 338 Effective length of database: 327 Effective search space: 110526 Effective search space used: 110526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory