Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_043690024.1 Z164_RS20580 3-hydroxyacyl-CoA dehydrogenase
Query= BRENDA::Q1D5Y4 (258 letters) >NCBI__GCF_000559025.1:WP_043690024.1 Length = 685 Score = 111 bits (277), Expect = 5e-29 Identities = 74/176 (42%), Positives = 102/176 (57%), Gaps = 8/176 (4%) Query: 24 NAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGADLKERATMAEDEVRAFLDG 83 N ++ +L EL L+ R++ + +VI A K F AGAD++E A D D Sbjct: 35 NTFAQDVLIELDALLERLALEPP-KGLVIRSAKAKGFIAGADIREFAEF--DAKGTIGDS 91 Query: 84 LRR---TFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAE--LGLTEVKLGII 138 +RR F+ + C +AAI+G +GGGTELALACD RVA+ A +GL EVKLGI Sbjct: 92 IRRGQQVFQRLADLPCPTVAAIHGFCMGGGTELALACDYRVASSDASTRIGLPEVKLGIY 151 Query: 139 PGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAVAYGLA 194 PG GG+ RL RLVG A D++LT R ++A A +GL +++A L+ A LA Sbjct: 152 PGWGGSVRLPRLVGAPAAFDMMLTGRALSAKAARGIGLVDKIAEPALLIDTAATLA 207 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 685 Length adjustment: 31 Effective length of query: 227 Effective length of database: 654 Effective search space: 148458 Effective search space used: 148458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory