Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Allergen Alt a 8; EC 1.1.1.138 (characterized)
to candidate WP_024890659.1 Z164_RS0110530 acetoacetyl-CoA reductase
Query= SwissProt::P0C0Y4 (266 letters) >NCBI__GCF_000559025.1:WP_024890659.1 Length = 246 Score = 125 bits (315), Expect = 7e-34 Identities = 87/247 (35%), Positives = 126/247 (51%), Gaps = 7/247 (2%) Query: 17 LKGKVVIVTGASGPTGIGTEAARGCAEYGADLAITYNSRAEGAEKNAKEMSEKYGVKVKA 76 + +V +VTG +G GIGT R G +A Y A A+ ++M E G + Sbjct: 1 MTSRVALVTGGTG--GIGTAICRRLHAAGHRVATNYRDEAR-AQAWLRKMRES-GCEATL 56 Query: 77 YKCQVNEYAQCEKLVQDVIKDFGKVDVFIANAGKTADNGILDATVEQWNEVIQTDLTGTF 136 V+ E++V+DV + G V++ I NAG T D T +QW EVI T+L F Sbjct: 57 VPGDVSSPEDAERMVRDVEAELGPVEILINNAGITRDTTFHKMTAQQWQEVINTNLNSVF 116 Query: 137 NCARAVGLHFRERKTGSLVITSSMSGHIANFPQEQASYNVAKAGCIHLAKSLANEWRDFA 196 N R V RERK G +V SS++G + QA+Y AKAG SLA E F Sbjct: 117 NVTRPVIEGMRERKWGRIVQISSINGQKGQY--GQANYAAAKAGMHGFTISLAQENARFG 174 Query: 197 -RVNSISPGYIDTGLSDFVPQDIQKLWHSMIPMGRDAKATELKGAYVYFASDASSYCTGS 255 VN++SPGYI T + VP+ +++ + IP GR E+ A +F D +++ TG+ Sbjct: 175 ITVNTVSPGYIGTDMVMAVPEPVREKIVAQIPTGRLGTPDEIAYAVAFFLPDEAAWITGA 234 Query: 256 DLLIDGG 262 +L +GG Sbjct: 235 NLSANGG 241 Lambda K H 0.316 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 246 Length adjustment: 24 Effective length of query: 242 Effective length of database: 222 Effective search space: 53724 Effective search space used: 53724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory