Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate WP_024890012.1 Z164_RS0107085 acyl-CoA dehydrogenase
Query= BRENDA::Q39QF5 (380 letters) >NCBI__GCF_000559025.1:WP_024890012.1 Length = 387 Score = 160 bits (405), Expect = 6e-44 Identities = 115/375 (30%), Positives = 181/375 (48%), Gaps = 9/375 (2%) Query: 4 LTEEQKLTLDMVRDVATREIAPRALELDEKSLFPEYARDLFAKLGLLNPLLPAAYGGTEM 63 L+EE++ D V + P + ++ FP A LG+L LP YG + Sbjct: 15 LSEEERAVQDAVARFTDERVLPIIGDCFDQGRFPAELIPEIAALGVLGATLPEEYGCAGL 74 Query: 64 GVLTLALILEELGRVCASTALLLIAQTD-GMLPIIHGGSPELKERYLRRFAGESTLLTAL 122 ++ LI +EL R + Q+ M PI GS E K R+L A ++ Sbjct: 75 NSVSYGLICQELERGDSGLRSFASVQSSLCMYPIYAYGSEEQKRRWLPDMAA-GRVIGCF 133 Query: 123 AATEPAAGSDLLAMKTRAVRQGDKYVINGQKCFITNGSVADVIVVYAYTDPEKGSKGISA 182 TEP GSD MKT A R G +V+NG K +ITNG++AD+++ +A T+ +GI Sbjct: 134 GLTEPHGGSDPANMKTHARRDGGDWVLNGSKMWITNGNIADIVIAWAQTE-----EGIQG 188 Query: 183 FVVEKGTPGLVYGRNESKMGMRGSINSELFFENMEVPAENIIGAEGTGFANLMQTLSTNR 242 FVVEK G + KM +R S+ S L+F+ + VP N + + G + L+ R Sbjct: 189 FVVEKDFAGFSAQEIKHKMSLRASVTSALYFDGVRVPEANRLPSV-KGLKGPLGCLTQAR 247 Query: 243 VFCAAQAVGIAQGALDIAVRHTQDRVQFGKPIAHLAPVQFMVADMATAVEASRLLTRKAA 302 +G A LD A+ ++++R+ FG+P+A Q +AD A + A++LL+ + Sbjct: 248 YGITWGPIGSAIACLDEALGYSKERMLFGRPVAATQSAQIKLADWARRITAAQLLSLQLG 307 Query: 303 ELLDDGDKKAVLYGSMAKTMASDTAMRVTTDAVQVLGGSGYMKENGVERMMRDAKLTQIY 362 L D G + S+AK A+ + +A +LGG+G E+ R + + Y Sbjct: 308 RLKDAGRMQPTQV-SLAKWNNCRMAIDIAREARDLLGGAGITTEHSPIRHALNLESVITY 366 Query: 363 TGTNQITRMVTGRAL 377 GT + ++V GR L Sbjct: 367 EGTETVHQLVVGREL 381 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 387 Length adjustment: 30 Effective length of query: 350 Effective length of database: 357 Effective search space: 124950 Effective search space used: 124950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory