Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate WP_024890448.1 Z164_RS0109400 isovaleryl-CoA dehydrogenase
Query= BRENDA::Q39QF5 (380 letters) >NCBI__GCF_000559025.1:WP_024890448.1 Length = 385 Score = 234 bits (598), Expect = 2e-66 Identities = 147/377 (38%), Positives = 212/377 (56%), Gaps = 5/377 (1%) Query: 4 LTEEQKLTLDMVRDVATREIAPRALELDEKSLFPEYARDLFAKLGLLNPLLPAAYGGTEM 63 L EE D VR A EIAPRA +D ++ FP+ ++GLL +PA YGG+ M Sbjct: 6 LGEELDALRDAVRRFAEAEIAPRAEAIDRENAFPQDLWPKLGEMGLLGMTVPAEYGGSAM 65 Query: 64 GVLTLALILEELGRVCASTALLLIAQTDGMLPIIHGGS-PELKERYLRRFAGESTLLTAL 122 G L + +EE+ R S L A ++ + ++ + P +ERYL + AL Sbjct: 66 GYLAHLVAMEEISRASGSVGLSYGAHSNLCVSNLYANATPAQRERYLPKLCS-GEWKGAL 124 Query: 123 AATEPAAGSDLL-AMKTRAVRQGDKYVINGQKCFITNGSVADVIVVYAYT-DPEKGSKGI 180 A +EP AGSD++ +M RA +GD +V NG K +ITNG ADV++VY T E GS+ I Sbjct: 125 AMSEPGAGSDVVGSMSCRAELRGDVWVANGNKMWITNGPEADVLIVYMRTAGREAGSRCI 184 Query: 181 SAFVVEKGTPGLVYGRNESKMGMRGSINSELFFENMEVPAENIIGAEGTGFANLMQTLST 240 +AF+VEKG PG + K+GMRGS EL FE+ E+PA N++G G LM L+T Sbjct: 185 TAFIVEKGMPGFRTAQKLDKLGMRGSNTCELVFEDCEIPAANVLGEVNHGVKVLMSGLNT 244 Query: 241 NRVFCAAQAVGIAQGALDIAVRHTQDRVQFGKPIAHLAPVQFMVADMATAVEASRLLTRK 300 R+ +G+ Q AL++ + + ++R QF I +Q +ADM TA+++SR + Sbjct: 245 ERLVLTGGPLGLMQAALELVLPYVRERRQFDAAIGTFGIMQAKLADMYTALQSSRAFAYQ 304 Query: 301 AAELLDDGDKKAVLYGSMAKTMASDTAMRVTTDAVQVLGGSGYMKENGVERMMRDAKLTQ 360 A D G + V S AS+ A++V + +Q LGG+GY+ E R++RDAKL Sbjct: 305 VARDYDAGHRSRVDAAS-CLLHASEAAVQVALEGIQALGGNGYINEYPAGRILRDAKLYA 363 Query: 361 IYTGTNQITRMVTGRAL 377 I GTN+I RM+ GR L Sbjct: 364 IGAGTNEIRRMLIGREL 380 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 385 Length adjustment: 30 Effective length of query: 350 Effective length of database: 355 Effective search space: 124250 Effective search space used: 124250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory