Align cyclohexa-1,5-dienecarbonyl-CoA hydratase monomer (EC 4.2.1.100) (characterized)
to candidate WP_024889854.1 Z164_RS0106175 enoyl-CoA hydratase
Query= metacyc::MONOMER-18320 (256 letters) >NCBI__GCF_000559025.1:WP_024889854.1 Length = 260 Score = 106 bits (264), Expect = 5e-28 Identities = 75/245 (30%), Positives = 114/245 (46%), Gaps = 6/245 (2%) Query: 14 VATITLNVPNS-NWLTIPMMKEINEALMDVKKDPTIQLLVFDHAGDKAFCDGVDVADHVP 72 + T+T+N P+ N L + + A D +D ++++V AG KAF G D+A+ Sbjct: 14 IRTLTVNRPDKLNALNAATLDALQAAFDDAAQDAAVRVVVLTGAGTKAFVAGADIAEMAE 73 Query: 73 EKVDEMIDLF---HGMFRNMAAMDVTSVCLVNGRSLGGGCELMAFCDIVIASEKAKIGQP 129 D + R++ + ++NG +LGGG EL C + IA++ A++GQP Sbjct: 74 LTAVAGRDFSARGQRLMRSIETFPKPVIAMINGFALGGGLELAMACHLRIAADSARLGQP 133 Query: 130 EINLAVFPPVAAAW-FPKIMGLKKAMELILTGKIISAKEAEAIGLVNVVLPVEGFREAAQ 188 E+NL + P ++ G +EL LTG I A A A+G+VN V+P EA + Sbjct: 134 EVNLGLIPGFGGTQRLLRLAGRAATLELCLTGAPIDAARALALGVVNRVVPAAELAEATR 193 Query: 189 KFMADFTSKSRPVAMWARRAIMAGLNLDFLQALKASEIIYMQGCMATEDANEGLASFLEK 248 A + + AG + L A E ATED EG +FLE+ Sbjct: 194 ALAAGLAEAAPLALRGVLDCVHAGGECALGEGL-AYETAQFGLMFATEDMREGTRAFLER 252 Query: 249 RKPVF 253 RKP F Sbjct: 253 RKPRF 257 Lambda K H 0.322 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 260 Length adjustment: 24 Effective length of query: 232 Effective length of database: 236 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory