Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate WP_043690024.1 Z164_RS20580 3-hydroxyacyl-CoA dehydrogenase
Query= BRENDA::D3RXI0 (252 letters) >NCBI__GCF_000559025.1:WP_043690024.1 Length = 685 Score = 90.5 bits (223), Expect = 8e-23 Identities = 54/136 (39%), Positives = 87/136 (63%), Gaps = 7/136 (5%) Query: 47 VIVFSGEGKSFSAGAEIKE--HFPDKAP--EMIRWFTQLIDKVLRCKAITVAAVKGFALG 102 +++ S + K F AGA+I+E F K + IR Q+ ++ TVAA+ GF +G Sbjct: 60 LVIRSAKAKGFIAGADIREFAEFDAKGTIGDSIRRGQQVFQRLADLPCPTVAAIHGFCMG 119 Query: 103 GGFELAIACDFVLASKNA--KLGVPEITLAHYPPVAIAL-LPRMIGWKNAYELILTGEAI 159 GG ELA+ACD+ +AS +A ++G+PE+ L YP ++ LPR++G A++++LTG A+ Sbjct: 120 GGTELALACDYRVASSDASTRIGLPEVKLGIYPGWGGSVRLPRLVGAPAAFDMMLTGRAL 179 Query: 160 TAERAFEIGLVNKVFE 175 +A+ A IGLV+K+ E Sbjct: 180 SAKAARGIGLVDKIAE 195 Lambda K H 0.318 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 685 Length adjustment: 31 Effective length of query: 221 Effective length of database: 654 Effective search space: 144534 Effective search space used: 144534 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory