Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate WP_024889589.1 Z164_RS0104740 enoyl-CoA hydratase
Query= reanno::psRCH2:GFF2389 (257 letters) >NCBI__GCF_000559025.1:WP_024889589.1 Length = 264 Score = 206 bits (524), Expect = 4e-58 Identities = 109/240 (45%), Positives = 149/240 (62%) Query: 15 ALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAKAFAAGADIKEMAELT 74 A + ++RP A NAL L + L +L AD + ++L + FAAGAD+KEM ++ Sbjct: 16 AELVIDRPAARNALCRSLTDAMAAHLDRLAADAAVRVVLLRAEGEHFAAGADLKEMLGIS 75 Query: 75 YPQIYLDDFFADADRIATRRKPLIAAVAGYALGGGCELALLCDMIFAADNARFGQPEVNL 134 Q DF + T KP++A V G+ALGGGCEL +CD++ AA+NA FG PEV + Sbjct: 76 AEQARATDFAGCCAPLGTFPKPVVALVQGFALGGGCELVEMCDIVLAAENAVFGHPEVRV 135 Query: 135 GVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVFPAESLLEETLKAAR 194 G +PG GGTQRL R +G AKAMD+ LTGR+MDA EAER+GLV+R+ P + LLEE + A Sbjct: 136 GTMPGAGGTQRLPRLLGMAKAMDLLLTGRRMDAREAERSGLVSRIVPPDHLLEEGRRLAA 195 Query: 195 VIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATADQKEGMAAFSEKRKPEF 254 +A S ++IK++ + + EG+R ER FH + D +EGM AF EKR P F Sbjct: 196 DMASLSGEVLVLIKQAARASASLPMDEGLRRERAAFHHTLSLPDHEEGMRAFLEKRPPRF 255 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 264 Length adjustment: 25 Effective length of query: 232 Effective length of database: 239 Effective search space: 55448 Effective search space used: 55448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory