Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate WP_024890501.1 Z164_RS0109685 thiolase family protein
Query= metacyc::MONOMER-3207 (400 letters) >NCBI__GCF_000559025.1:WP_024890501.1 Length = 391 Score = 246 bits (628), Expect = 8e-70 Identities = 147/398 (36%), Positives = 222/398 (55%), Gaps = 9/398 (2%) Query: 1 MRDVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQA 60 M+DV I A RT IG F G GV L A ++ + + + DQVDEV GC A Sbjct: 1 MQDVVIVGAKRTAIGSFLGQFTGVPTPTLGAAAIQGALA-HAGLGADQVDEVILGCVLPA 59 Query: 61 GEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESM 120 G + AR A AG+P++ T+N++C SGM +I I +G + +AGG+ESM Sbjct: 60 GL-GQAPARQASRAAGIPDAAGCTTVNKVCGSGMKSIMFGHDLIRAGSSSVVVAGGMESM 118 Query: 121 SRAPFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRAD 180 + AP ++ + +G + W + + Y +M D + Y SR D Sbjct: 119 TNAPHLLNGSRTGVRYGSAEFLDHMAWDGLT----NPYDGLAMGVFGDRTCEAYGFSRED 174 Query: 181 QDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGETIVERDEHLRPETTLEALTKLKPV 240 DAF+ S ++A A A G F +E+VPV + +KGET+V+ DE + L + L+ Sbjct: 175 LDAFSAESARRAQEAVAGGAFRDEVVPVTVKGRKGETVVDTDEE-PGKIDLARIPTLRAA 233 Query: 241 NGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPVP 300 G + +TA ++S ++DGAAA +L SA+ + GL P AR++ A AP PV Sbjct: 234 FGKEGRLTAASSSKISDGAAATVLMSADEAARRGLAPLARIVAHAGHAQAPEWFTTAPVA 293 Query: 301 AVRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGM 360 A+R + +R G +V D D+ E+NEAFA +A +++LG+ ++N NGGA ALGHP+G Sbjct: 294 AIRTVLQRAGWSVEDVDLFEVNEAFACVAMAPMKDLGIPHQ--KLNVNGGACALGHPIGA 351 Query: 361 SGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIE 398 SGARLV+T LH L+ R+G+A++C+G G+ A+A+E Sbjct: 352 SGARLVVTLLHALKARNLRRGIASLCIGGGEATAIAVE 389 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 391 Length adjustment: 31 Effective length of query: 369 Effective length of database: 360 Effective search space: 132840 Effective search space used: 132840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory