Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_024889589.1 Z164_RS0104740 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_000559025.1:WP_024889589.1 Length = 264 Score = 108 bits (270), Expect = 1e-28 Identities = 76/241 (31%), Positives = 117/241 (48%), Gaps = 5/241 (2%) Query: 19 LTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGADNFFCAGGNLNRLLENRAK 78 L + P ARNAL + A LD + D ++R V++ F AG +L +L A+ Sbjct: 18 LVIDRPAARNALCRSLTDAMAAHLDRLAADAAVRVVLLRAEGEHFAAGADLKEMLGISAE 77 Query: 79 DPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDLIVAADDAKFVMSY 138 QA++ D A + L KPV+A V G A G G L CD+++AA++A F Sbjct: 78 ----QARATDF-AGCCAPLGTFPKPVVALVQGFALGGGCELVEMCDIVLAAENAVFGHPE 132 Query: 139 ARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKLTKPGTARDAAVA 198 RVG P GG+ L + L A ++L+ G+ + A G+V+++ P + Sbjct: 133 VRVGTMPGAGGTQRLPRLLGMAKAMDLLLTGRRMDAREAERSGLVSRIVPPDHLLEEGRR 192 Query: 199 WADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHREGLEGISAFLEKRA 258 A ++ +S + IK A+ + P+ E L ER F +L + EG+ AFLEKR Sbjct: 193 LAADMASLSGEVLVLIKQAARASASLPMDEGLRRERAAFHHTLSLPDHEEGMRAFLEKRP 252 Query: 259 P 259 P Sbjct: 253 P 253 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 264 Length adjustment: 25 Effective length of query: 237 Effective length of database: 239 Effective search space: 56643 Effective search space used: 56643 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory