Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_024890509.1 Z164_RS0109725 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_000559025.1:WP_024890509.1 Length = 266 Score = 106 bits (265), Expect = 4e-28 Identities = 89/257 (34%), Positives = 122/257 (47%), Gaps = 20/257 (7%) Query: 15 STLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGADNFFCAGGNLNRLLE 74 + L L L+ P NA + A AL+ DP+IRAVVI GA F AG +LN + Sbjct: 12 AALRLRLARPQLHNAFDAALIAELTAALEGAAADPAIRAVVIEGAGASFSAGADLNWM-- 69 Query: 75 NRAKDPSVQAQSID---LLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDLIVAADD 131 RA + +A++ D LA + L KP +A V GAA G G L CD+ + + Sbjct: 70 -RAMAGASEAENRDDALALARLMRTLDELPKPTLARVHGAAFGGGVGLVACCDIAIGVPE 128 Query: 132 AKFVMSYARVGLTPDGGGSWFLAQALPRQ-----LATEVLIEGKPIGAARLHELGVVNKL 186 AKF ++ +R+GL P + +A PRQ EV G+ + LHE+ Sbjct: 129 AKFGLTESRLGLLPAVISPYVIAAIGPRQARRWFATAEVFDAGRALAMGLLHEV------ 182 Query: 187 TKPGTARDAAV-AWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLH-HR 244 P A DAAV L K P + A K LV QP + + +A+L Sbjct: 183 -VPAEALDAAVERQIALLLKAGPFAAADAKRLVRDVLAQPDRDRRDHDNAALIAALRVSA 241 Query: 245 EGLEGISAFLEKRAPVY 261 EG EG+SAFL+KRAP + Sbjct: 242 EGQEGLSAFLDKRAPAW 258 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 266 Length adjustment: 25 Effective length of query: 237 Effective length of database: 241 Effective search space: 57117 Effective search space used: 57117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory