Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_024889962.1 Z164_RS0106825 3-oxoadipyl-CoA thiolase
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_000559025.1:WP_024889962.1 Length = 401 Score = 252 bits (643), Expect = 2e-71 Identities = 164/410 (40%), Positives = 228/410 (55%), Gaps = 37/410 (9%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKR-AGIDPKEVEDVVMGAAMQ 59 M+EA + RTPIG+ Y G+L+ L I + R G+DP+ V+DV G A Q Sbjct: 1 MSEAFVCDAVRTPIGR-YGGSLSGVRADDLGAVPIRALLARNPGLDPEAVDDVFFGCANQ 59 Query: 60 QGATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGES 119 G N+AR +LL AGLP + G T++R CASGL+A+ AAR++ +E+A+ GG ES Sbjct: 60 AGEDNRNVARMSLLLAGLPASVPGVTLNRLCASGLEAVGQAARAIRSGEIELAIAGGVES 119 Query: 120 ISLVQ----------------NDKMNTFHAVDPALEAIKGDVYMAMLDTAETVAKRYGIS 163 ++ D + V+P L+A G M T E +A+ +G+S Sbjct: 120 MTRAPFVVGKADSAFGRGQRLEDTTMGWRFVNPRLQARYGAETMPQ--TGENLAREHGVS 177 Query: 164 RERQDEYSLESQRRTAAAQQGGKFNDEIAPIST---KMGVVDKATGAVSFKDITLSQDEG 220 RE QD ++L SQ+R AAA+ G +EI + K G D+A V DE Sbjct: 178 REDQDAFALRSQQRAAAARAAGFLAEEIVAVEVPGRKRG--DRALAEV---------DEH 226 Query: 221 PRPETTAEGLAGLKAVRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGM 280 PR +TT E LAGLK + G ++TAGNAS ++DGA+A V+ ++ A GL+P G+ Sbjct: 227 PRADTTLEALAGLKPLFPGG-SVTAGNASGINDGAAALVVAGERAVARFGLRPRARILGL 285 Query: 281 VSYGCEPDEMGIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGI--DPEK 338 + G EP MGIGPV A +LL R GL + D ELNEAFA Q L LG+ D Sbjct: 286 AAAGVEPRVMGIGPVPATRKLLARLGLGIGDFDAIELNEAFASQSLAVLRALGLPDDAAH 345 Query: 339 LNVNGGAISVGHPYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSA 388 +N NGGAI++GHP GMSGARLA + + ++ +Y + T+C+G GMG A Sbjct: 346 VNANGGAIALGHPLGMSGARLALTLVHQLQKTGGRYGLATLCIGVGMGLA 395 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 38 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 401 Length adjustment: 31 Effective length of query: 364 Effective length of database: 370 Effective search space: 134680 Effective search space used: 134680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory