Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_043690930.1 Z164_RS0118500 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000559025.1:WP_043690930.1 Length = 319 Score = 92.8 bits (229), Expect = 7e-24 Identities = 65/221 (29%), Positives = 119/221 (53%), Gaps = 15/221 (6%) Query: 9 TFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRYMGEELVGQ 68 T+ G ++AL V+++V G+ L+G NGAGKSTL+ + A SG++ G ++ + Sbjct: 22 TYAGGVEALRGVSLDVAPGDFYALLGPNGAGKSTLIGIVSSLVNATSGTVEVFGVDIARR 81 Query: 69 DSSHIMRKSIAVVPE--GRRVFAR-LTVEENLAMGGFF----TDKGDYQEQMDKVLHLFP 121 + + I +VP+ +F + + N A GF+ + + E + HL+ Sbjct: 82 RGEAM--RLIGLVPQEINFNLFEQPFDILVNYA--GFYGVPRAEAAERAEAELRAAHLWG 137 Query: 122 RLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQLRK 181 K R R T+SGG ++ L I RA+M++P+LL+LDEP+ G+ I + ++ ++++ Sbjct: 138 --KARTMSR--TLSGGMKRRLMIARAMMTRPRLLILDEPTAGVDIEIRRGMWQALQEINA 193 Query: 182 DGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLT 222 G T+ L +A + ++++GR+V QG+ ALL+ Sbjct: 194 AGTTIILTTHYLEEAEALCRNLAIIDHGRIVEQGSMRALLS 234 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 319 Length adjustment: 25 Effective length of query: 208 Effective length of database: 294 Effective search space: 61152 Effective search space used: 61152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory