GapMind for catabolism of small carbon sources

 

Protein WP_025765262.1 in Dyadobacter tibetensis Y620-1

Annotation: NCBI__GCF_000566685.1:WP_025765262.1

Length: 225 amino acids

Source: GCF_000566685.1 in NCBI

Candidate for 52 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artP med Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 40% 82% 144.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-histidine catabolism hisP med Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 40% 82% 144.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-lysine catabolism hisP med Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 40% 82% 144.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-glucosamine (chitosamine) catabolism AO353_21725 med ABC transporter for D-glucosamine, ATPase component (characterized) 41% 77% 135.2 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 85% 149.4 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 85% 149.4 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-glutamate catabolism gltL lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 39% 85% 149.4 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 148.3 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 148.3 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 148.3 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 148.3 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 148.3 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 148.3 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 148.3 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 38% 61% 148.3 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 36% 87% 146.7 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 84% 142.5 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 84% 142.5 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 84% 142.5 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 84% 142.5 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 84% 142.5 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 39% 84% 142.5 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 38% 87% 142.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 38% 60% 139.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 39% 77% 137.9 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 39% 77% 137.9 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 61% 134.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 61% 134.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 61% 134.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 61% 134.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 61% 134.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 61% 134.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 35% 89% 134.4 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 36% 83% 132.9 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-mannitol catabolism mtlK lo MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 37% 57% 127.5 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 57% 127.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 33% 72% 114 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-isoleucine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 84% 110.2 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-leucine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 84% 110.2 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-valine catabolism livF lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 32% 84% 110.2 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 34% 55% 105.1 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 87% 97.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 87% 97.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 87% 97.8 Complete genome, strain BL23, component of Antimicrobial peptide exporter, ABC12 or YvoST 49% 211.8

Sequence Analysis Tools

View WP_025765262.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLTITNLQKIFATEEVETTALNGINLTINDGEFVAIMGPSGCGKSTLLNIIGLLDNPSSG
TYNFYGSDVEKMSERQRAQLRKGNVGFVFQSFNLIDELTVFENVELPLLYLKVPSKERDE
KVEATLKRMNMMHRRNHFPQQLSGGQQQRVAIARAVVAKPKLILADEPTGNLDSANGKDV
MNLLQELNEEGTTIAMVTHSPYDASFAHRTVNLFDGKIVTENFHV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory