GapMind for catabolism of small carbon sources

 

Protein WP_044200027.1 in Dyadobacter tibetensis Y620-1

Annotation: NCBI__GCF_000566685.1:WP_044200027.1

Length: 274 amino acids

Source: GCF_000566685.1 in NCBI

Candidate for 61 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism aapP med ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 41% 84% 146.7 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtP; EC 7.4.2.- (characterized) 41% 88% 145.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-asparagine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 85% 145.2 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-aspartate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 85% 145.2 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-glutamate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 85% 145.2 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-leucine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 85% 145.2 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-proline catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 85% 145.2 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-glutamate catabolism gltL med Amino acid ABC transporter ATP binding protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized) 41% 81% 139 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 46% 55% 177.2 MalK aka PF1933, component of Maltooligosaccharide porter (Maltose is not a substrate, but maltotriose is.) 40% 176.8
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 46% 55% 177.2 MalK aka PF1933, component of Maltooligosaccharide porter (Maltose is not a substrate, but maltotriose is.) 40% 176.8
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 45% 52% 168.3 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 68% 165.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 68% 165.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 68% 165.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 68% 165.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 68% 165.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 68% 165.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 68% 165.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 68% 165.6 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 43% 53% 162.5 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 39% 66% 158.7 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 43% 53% 155.2 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 43% 52% 151.4 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 53% 149.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 53% 149.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 53% 149.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 53% 149.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 53% 149.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 53% 149.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 53% 149.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 43% 52% 148.7 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 40% 59% 148.3 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 68% 147.5 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 68% 147.5 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 68% 147.5 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 68% 147.5 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 53% 145.2 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 80% 144.4 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 80% 144.4 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 80% 144.4 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 62% 144.1 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 62% 144.1 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 40% 53% 143.7 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 53% 143.7 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 39% 55% 143.7 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 39% 62% 142.5 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 40% 58% 140.2 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 38% 55% 139.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 36% 72% 137.9 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 39% 86% 137.1 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 53% 134.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 53% 134.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 53% 134.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 53% 134.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 53% 134.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 53% 134.8 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 37% 86% 131.3 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 40% 74% 131 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 40% 74% 131 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 31% 79% 107.1 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 33% 55% 105.5 Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 46% 177.2

Sequence Analysis Tools

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MDISLYIPMGSRLAITGPSGAGKTTILRQIAGLSIPQAGKITVGDNCWLDTQNGISIPPQ
GRNIGFVFQDYALFPHLTVYENLSYGLRNGQDTKVVDMLLERIGLMELAGRKPDQLSGGQ
QQRVALARALVRKPVLLLLDEALSALDSAMRLSLQGLILELQREQGFTLIMVTHHLGEIF
RMADRVVQLDHGQVVGQGSPAVCFTSQSLPRAALVLYGEVISSQVFPDHILVTALVDEQL
RELEVPLDRQDELREGQAFTLTYEHSQALIQRIN

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory