Align BadK (characterized)
to candidate WP_025763018.1 X939_RS0109475 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_000566685.1:WP_025763018.1 Length = 259 Score = 121 bits (303), Expect = 2e-32 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 4/247 (1%) Query: 11 QGRVGI--ITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVI-AGNTRAFAAGADI 67 Q + GI I+LNRP V +ALN L+ + A+ +D+ + A+++ A AF +GAD+ Sbjct: 8 QNKEGIVRISLNRPHVHHALNKELIKEITLAIEVAASDEEVRAVLLTAEGDTAFCSGADL 67 Query: 68 ASMAAWSYS-DVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSA 126 D + IR + KPV+ + GLA G G LAL+CD+V+A SA Sbjct: 68 KDTLDSKIDVDQTLREYYNPMIMAIRSLPKPVVCRLNGLAVGAGASLALSCDMVVATESA 127 Query: 127 KFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRL 186 A +++GL+P AG T LPR +G A+A + + + + A EA G+++ V L Sbjct: 128 YLAFMFVQIGLMPDAGATFILPRLVGSARAFALASTGQRVTAREAQHIGMIAHAVPASEL 187 Query: 187 RDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQA 246 L A+ A+K+ LN++ S+L + + ER H + DA+ GI + Sbjct: 188 DSTVEKLLLYYRHAPTQAIAAMKQVLNQSQHSSLEQMLDLERIHQHQLSKTTDAKNGISS 247 Query: 247 FLEKRAP 253 FL+K+ P Sbjct: 248 FLQKKKP 254 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 94 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory