Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_025762143.1 X939_RS0104855 2-hydroxyacid dehydrogenase
Query= BRENDA::A0A140N893 (329 letters) >NCBI__GCF_000566685.1:WP_025762143.1 Length = 332 Score = 339 bits (870), Expect = 5e-98 Identities = 165/328 (50%), Positives = 227/328 (69%) Query: 1 MKLAVYSTKQYDKKYLQQVNESFGFELEFFDFLLTEKTAKTANGCEAVCIFVNDDGSRPV 60 M++A ++TK YD+ + + ++ +F+ L +TA+ A G EAVC+FVND R Sbjct: 1 MQIAFFNTKSYDQTFFNESIYLKSHKITYFEVALNSQTARLAEGAEAVCVFVNDTVDRNT 60 Query: 61 LEELKKHGVKYIALRCAGFNNVDLDAAKELGLKVVRVPAYDPEAVAEHAIGMMMTLNRRI 120 ++ L GVK IALRCAGFNNVDL AA+E ++VVRVPAY PE+VAEHA+ +++TLNR+ Sbjct: 61 IQNLSVLGVKIIALRCAGFNNVDLKAAREYHIEVVRVPAYSPESVAEHAVALILTLNRKT 120 Query: 121 HRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSAA 180 HRA+ R R+ NFS+E LTGF ++ KT GV+GTG IG + +I+ GFG ++LA+D + Sbjct: 121 HRAFNRVREGNFSIEHLTGFNLFNKTVGVVGTGLIGASFCKIMLGFGCKVLAYDIQKNEN 180 Query: 181 ALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFDQMKNGVMIVNTSRGALIDS 240 + GV+Y L LF S++ISLHCPL P+ H+++ + ++MK+GVMI+NTSRG LID+ Sbjct: 181 LINHGVQYTSLDELFRHSEIISLHCPLLPQTTHIIDTESINKMKSGVMIINTSRGGLIDT 240 Query: 241 QAAIEALKNQKIGSLGMDVYENERDLFFEDKSNDVIQDDVFRRLSACHNVLFTGHQAFLT 300 +AAIE LK KIG LG+DVYE E +LFF+D VIQDDV RL + NVL TGH F T Sbjct: 241 KAAIEGLKKGKIGYLGIDVYEQEANLFFKDHGETVIQDDVIARLISFPNVLLTGHLGFFT 300 Query: 301 AEALTSISQTTLQNLSNLEKGETCPNEL 328 EAL I+ TL+NLS+ E + N + Sbjct: 301 QEALEEIAHITLENLSDFENNKALSNRV 328 Lambda K H 0.320 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 332 Length adjustment: 28 Effective length of query: 301 Effective length of database: 304 Effective search space: 91504 Effective search space used: 91504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory