Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_025763370.1 X939_RS0111250 glucose 1-dehydrogenase
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >NCBI__GCF_000566685.1:WP_025763370.1 Length = 257 Score = 143 bits (360), Expect = 4e-39 Identities = 91/258 (35%), Positives = 136/258 (52%), Gaps = 11/258 (4%) Query: 18 RLKNKVVLLTGAAQGIGEAIVATFASQQARLVISDIQGEKVEKVAAHWREQGADVVAIKA 77 RLKNKV L+TG + GIG FA + A++V+SD+ E ++ A EQG + I + Sbjct: 2 RLKNKVALITGGSGGIGRETALLFAREGAQIVVSDVNQEMGQQTADMIVEQGGEAYFIYS 61 Query: 78 DVSRQQDLHAMARLAIELHGRIDVLVNCAGVNVFRDPLQMTEED--WHRCFAIDLDGAWY 135 DVS+ D AM E G++++L N AG+ D MT E+ W I+ G + Sbjct: 62 DVSKDADCKAMVAFTEEKFGKLNILFNNAGIMHSDDDNAMTTEESVWDLTMNINAKGVFL 121 Query: 136 GCKAVLPQMIEQGIGSIINIASTHSTHIIPGCFP---YPVAKHGLLGLTRALGIEYAPKG 192 GCK +P + G GS+IN AS I+ P Y +K +L LTR L + +A + Sbjct: 122 GCKYGIPALQRAGGGSVINTAS--FVAILGAATPQIAYTASKGAVLALTRELAVIHAREN 179 Query: 193 IRVNAIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEA 252 IRVNA+ PG + T+L + + N ++QR P R G+ E+A +FLASDE+ Sbjct: 180 IRVNALCPGPLRTELLMKFLN----TEEKKQRRLVHVPMGRFGEAKEMASAVLFLASDES 235 Query: 253 PFINASCITIDGGRSVMY 270 ++ + +DGG + Y Sbjct: 236 TYVTGTDFLVDGGITAAY 253 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 257 Length adjustment: 25 Effective length of query: 247 Effective length of database: 232 Effective search space: 57304 Effective search space used: 57304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory