Align Threonine dehydratase 2 biosynthetic, chloroplastic; SlTD2; Threonine deaminase 2; EC 4.3.1.17; EC 4.3.1.19 (characterized)
to candidate WP_025764063.1 X939_RS0114765 threonine ammonia-lyase IlvA
Query= SwissProt::P25306 (595 letters) >NCBI__GCF_000566685.1:WP_025764063.1 Length = 417 Score = 239 bits (609), Expect = 2e-67 Identities = 133/378 (35%), Positives = 219/378 (57%), Gaps = 7/378 (1%) Query: 113 SPLELAEKLSDRLGVNFYIKREDKQRVFSFKLRGAYNMMSNLSREELDKGVITASAGNHA 172 +PL + LS++ N Y+KRED Q V S+K+RGAYN M++LS ++L +GV+ ASAGNHA Sbjct: 26 TPLLHNQHLSEQYQANVYLKREDLQTVRSYKIRGAYNKMASLSMQQLAEGVVCASAGNHA 85 Query: 173 QGVALAGQRLNCVAKIVMPTTTPQIKIDAVRALGGDVV---LYGKTFDEAQTHALELSEK 229 QGVA A Q++ I MPTTTP K+ VR G + + L G T+D+A +++ E Sbjct: 86 QGVAYACQKMQVKGAIFMPTTTPAQKVKQVRLFGKEWIEIHLVGDTYDDAYHASMDYREA 145 Query: 230 DGLKYIPPFDDPGVIKGQGTIGTEINRQLK-DIHAVFIPVGGGGLIAGVATFFKQIAPNT 288 ++ PFDD VI+GQGT+G EI + +I + + +GGGGL +G++T FKQ++P T Sbjct: 146 TNAVFVHPFDDLQVIEGQGTVGLEIFKDADFNIDYLLMAIGGGGLASGISTVFKQLSPQT 205 Query: 289 KIIGVEPYGAASMTLSLHEGHRVKLSNVDTFADGVAVALVGEYTFAKCQELIDGMVLVAN 348 K+IGVEP G+ +M SL G V L ++D F DG AV G+ TF C + ++ ++L+ Sbjct: 206 KLIGVEPLGSPTMHDSLAAGQVVTLEHIDKFVDGAAVRRAGDITFQVCSKSLEKIILIPE 265 Query: 349 DGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYKIKNENIVAIASGANMDFSKLHKV 408 + ++I +Y+E + E +GA+ +A E +IK +N+V + SG N D ++ ++ Sbjct: 266 GRVCSSILQLYNEEAIVAEPAGALTVAALDQIRE--EIKGKNVVLLISGGNNDITRTEEI 323 Query: 409 TELAGLGSGKEALLATFMVEQQGSFKTFVGLVG-SLNFTELTYRFTSERKNALILYRVNV 467 E + L G + ++ G+F+ F+ ++G + + Y + R+ L + + Sbjct: 324 KERSMLFEGLKHYFIIRFPQRSGAFREFLNVLGPNDDVARFEYVKKTSREQGPALVGIEL 383 Query: 468 DKESDLEKMIEDMKSSNM 485 D + ++ M + + Sbjct: 384 KNREDFQPLLARMDEAKI 401 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 563 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 595 Length of database: 417 Length adjustment: 34 Effective length of query: 561 Effective length of database: 383 Effective search space: 214863 Effective search space used: 214863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory