Align PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate WP_051511604.1 N825_RS05915 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q88NY5 (256 letters) >NCBI__GCF_000576635.1:WP_051511604.1 Length = 252 Score = 216 bits (551), Expect = 3e-61 Identities = 120/244 (49%), Positives = 158/244 (64%), Gaps = 7/244 (2%) Query: 13 MISIKNVNKWYGDFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKCVNALEPFQKGDIVV 72 ++S++ V+K +GD +VL +V+ GEV+ + G SGSGKST ++C+N LE Q+G I V Sbjct: 14 IVSLRGVHKSFGDVEVLRGLDLDVRMGEVIALLGRSGSGKSTALRCINGLEKIQRGTITV 73 Query: 73 DGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQRKVLGRSEAEATKKGLAL 132 G +A +L LR VG+VFQ + LFPHLT+ +N+TI+ + V G A+ Sbjct: 74 CGHEVARMGRDLRPLRKDVGIVFQSYNLFPHLTVEQNVTISPKLVKGVDAKTASLLAADT 133 Query: 133 LDRVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVSEVLDVMV 192 L RVGL +P QLSGGQQQRVAIARALAM+P VMLFDE TSALDPE+ EVL M Sbjct: 134 LARVGLLDKRDAYPEQLSGGQQQRVAIARALAMEPKVMLFDEVTSALDPELTGEVLRAME 193 Query: 193 QLAQEGMTMMCVTHEMGFARKVANRVIFMDKGSIIEDCTKEEFFGDQSARDQRTQHLLSK 252 +LA++GMTM+ VTHE+ FARKVA+RV+FM +G I E G S D L + Sbjct: 194 RLARDGMTMIVVTHEVAFARKVADRVVFMYRGQIRET-------GPASLLDTPQTDELKQ 246 Query: 253 ILQH 256 L+H Sbjct: 247 FLEH 250 Lambda K H 0.319 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 252 Length adjustment: 24 Effective length of query: 232 Effective length of database: 228 Effective search space: 52896 Effective search space used: 52896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory