Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_051511316.1 N825_RS00145 ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000576635.1:WP_051511316.1 Length = 269 Score = 246 bits (627), Expect = 5e-70 Identities = 126/250 (50%), Positives = 173/250 (69%), Gaps = 10/250 (4%) Query: 22 AIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIV 81 A+ + ++K +GQ VL+ ++L H G+ I + G SGSGKST +RCIN LE G++ V Sbjct: 20 AVVVEDLHKRFGQLEVLKGVSLVAHEGDVISMIGSSGSGKSTFLRCINLLETPDEGRVWV 79 Query: 82 DGI----------ELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPK 131 +G + +D K +D++RS +GMVFQ FNL+ H+T+L+N+ AP+ V VPK Sbjct: 80 NGELIRMKQGRHHAVPADAKQVDRIRSGLGMVFQGFNLWTHMTVLQNVIEAPVHVLGVPK 139 Query: 132 REAEETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPE 191 EA + A L+KV + +A YP LSGGQQQRVAIAR+L M+PK+MLFDEPTSALDPE Sbjct: 140 AEAIDRAEALLQKVGLEAKASSYPSHLSGGQQQRVAIARALAMQPKVMLFDEPTSALDPE 199 Query: 192 MIKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSE 251 ++ EVL M QLA+EGMTM+ VTHEMGFA+ V++ VIF+ G+I EQ P NP+S+ Sbjct: 200 LVGEVLRVMRQLADEGMTMIIVTHEMGFAREVSSEVIFLHQGRIEEQGPPDQVLANPRSD 259 Query: 252 RTKQFLSQIL 261 R +QFL++ L Sbjct: 260 RCRQFLARNL 269 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 269 Length adjustment: 25 Effective length of query: 238 Effective length of database: 244 Effective search space: 58072 Effective search space used: 58072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory