Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_037454069.1 N825_RS16595 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000576635.1:WP_037454069.1 Length = 354 Score = 323 bits (829), Expect = 3e-93 Identities = 172/361 (47%), Positives = 236/361 (65%), Gaps = 8/361 (2%) Query: 1 MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI 60 M SV +RD+ +GA VL +++DI GEF++L+G SGCGKSTLL +AGL ++ G+I Sbjct: 1 MASVEIRDVRKAYGAAQVLHGVSVDIQDGEFVILVGPSGCGKSTLLRMLAGLESITGGEI 60 Query: 61 FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEI 120 I R V PK+R I MVFQ+YALYP MTV +N++F +++ + ++IE RV +A++I Sbjct: 61 RIGPRVVNDVPPKERDIAMVFQNYALYPHMTVAENMAFSMRLRRAKKSDIEVRVNKAADI 120 Query: 121 LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH 180 L + LL R P ELSGGQRQRVA+GRA+VRD VFLFDEPLSNLDAKLR +R EIK LH Sbjct: 121 LGLTKLLDRYPKELSGGQRQRVAMGRAIVRDPKVFLFDEPLSNLDAKLRVAMRAEIKELH 180 Query: 181 QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN 240 Q LK T +YVTHDQIEA+T+AD+I VM+ G+++Q+ P+ +Y+ P N+FVAGFIGSP+MN Sbjct: 181 QRLKTTTVYVTHDQIEAMTMADKIVVMRDGIVEQMGAPLELYDRPGNVFVAGFIGSPAMN 240 Query: 241 FFRGEVEPKDGRSFVRAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDGEPTH 300 G +E G +FV +GG+ + G+ + GLRPEH+ + +A G P Sbjct: 241 LLEGRIE---GGAFVTSGGMRLPLPTDRFTGAAASGRPAIYGLRPEHITLSDA--GVPVE 295 Query: 301 QAVVDIEEPMGADNLLWLTFAGQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDAESENR 360 VV EP G++ L+ + + + PG T+R+ D +FDAES R Sbjct: 296 VVVV---EPTGSETLIVVKGGHTELDCLFRSRILPNPGETLRIQPDTAHVHLFDAESGQR 352 Query: 361 L 361 L Sbjct: 353 L 353 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 354 Length adjustment: 29 Effective length of query: 332 Effective length of database: 325 Effective search space: 107900 Effective search space used: 107900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory