Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_037454711.1 N825_RS16865 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000576635.1:WP_037454711.1 Length = 362 Score = 313 bits (801), Expect = 6e-90 Identities = 173/366 (47%), Positives = 232/366 (63%), Gaps = 9/366 (2%) Query: 1 MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI 60 M SV + + +G V+ ++++I+ EF+VL+G SGCGKSTLL +AGL ++ G+I Sbjct: 1 MASVGIAQVRKAYGQHEVIHGIDIEIEDEEFVVLVGPSGCGKSTLLRMVAGLEQITGGEI 60 Query: 61 FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEI 120 I V PK+R I MVFQ+YALYP MTV N++F L++ K P ++KRV+ A++I Sbjct: 61 AIGGTVVNLVPPKERDIAMVFQNYALYPHMTVFNNMAFSLQLRKSDPDMVQKRVREAADI 120 Query: 121 LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH 180 L + P L R P +LSGGQRQRVA+GRA+VRD VFLFDEPLSNLDAKLR ++R EIK LH Sbjct: 121 LGLVPYLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRTEIKALH 180 Query: 181 QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN 240 Q L+ T IYVTHDQ+EA+T+ADRI VM G ++Q+ P+ +Y+ P N FVAGFIGSPSMN Sbjct: 181 QRLRTTSIYVTHDQVEAMTMADRIVVMHDGHVEQIGTPLELYDYPANTFVAGFIGSPSMN 240 Query: 241 FFRGEVEPKDGRS--FVRAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKV--DEARDG 296 FF G +DGR+ AG I F V TR GQ V G+RP H+ + +A G Sbjct: 241 FFNGTFR-RDGRAAWVEVAGDIRFPVEPL---TRANDGQSVTYGIRPGHLTLVNGDAAPG 296 Query: 297 EPTH-QAVVDIEEPMGADNLLWLTFAGQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDA 355 P A + + EP G D +++ A Q + + PG T+ L M +FD+ Sbjct: 297 FPKGVAATIQVIEPTGDDTVVFCRMANQEACAMFVERHAFRPGDTIMLMPRMANGHVFDS 356 Query: 356 ESENRL 361 S +RL Sbjct: 357 ASGHRL 362 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 362 Length adjustment: 29 Effective length of query: 332 Effective length of database: 333 Effective search space: 110556 Effective search space used: 110556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory